KEGG   Tuber melanosporum: GSTUM_00006876001Help
Entry
GSTUM_00006876001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tml  Tuber melanosporum
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GSTUM_00006876001
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    GSTUM_00006876001
   00603 Glycosphingolipid biosynthesis - globo series
    GSTUM_00006876001
   00604 Glycosphingolipid biosynthesis - ganglio series
    GSTUM_00006876001
   00511 Other glycan degradation
    GSTUM_00006876001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GSTUM_00006876001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 574 aa AA seqDB search
MTSVTALWPIPESYKHGDTTVWLSPGVELVFDSPPETRTATKHKVHEAWSRTRDIIFQER
LVPWKFYPRGAKFEPENKFGGVIKKVFVRQTSVDKPEPVPYGEFDESYTLIIPISGGNFT
SLEANGVGATLDEGREPGAVYITAGSSLGVLHAFTTLSQLFYYSNNHRDGVYSKLAPVEI
NDKPKFQHRGLNMDVARQWYPKEEILKIIDTLSWNKMNRLHLHVTDSQSWPLEIPAMPNL
AARGAYADGLTYSPQDLQDILTWGRSRGVEVIVEIDMPGHTTSIAEAYPELITGRDKQPD
WDQYAAQPPSGSLKLRNPAVKKFLTTLFDDLLPRLKSHSQYFHTGGDEVNKNVYKFDENI
KSNDSAVLQPALQDFLSHVHTELGRHGVTPFVWEEMLLEWNLTLPKDSIVQTWISEESTK
KVIEKGHRVIAGNYNFWYLDCGHGQWLDFLPASYETYYPFNDYCSPRKSWRHIYSYDPTA
GLTQEQAKLVLGGEVHAWSEQTDPINFDSVVWPRASAAAEVLWSGRTDAAGNNRTFPDAS
PRLAEFRERLVLRGVGAGPIQQLWCHQHPGGCQL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgacatccgtcactgcgctctggcctatccccgagagctacaaacatggcgataccaca
gtttggttatcgccgggcgtggaattggttttcgattcgccccccgaaacacgaacagcc
acaaaacacaaagtccacgaggcctggagccgcacccgggacataatattccaggaacgc
ttagtcccctggaaattttacccccgtggggccaaattcgaaccggaaaacaagttcggc
ggggtgatcaagaaggtattcgtcagacagacatccgtggacaagccggagcctgtgccc
tatggagaattcgatgagagctacacgctcataatccccatctctggtgggaactttacc
tctctggaggctaatggggtgggagcgaccctcgatgaagggagggagccgggagcggtc
tacatcaccgctgggtcaagcctgggcgtgctgcatgccttcacgacgctcagtcagcta
ttctactactccaacaaccaccgcgacggggtgtactccaaactcgcgccggtggaaata
aacgacaagcccaagttccagcaccgcggactaaacatggacgtggcgaggcaatggtac
ccgaaggaggaaatcctgaagatcatcgacaccctctcctggaacaaaatgaacagactc
cacctgcacgtgacggactcgcaatcctggccgctggagatccccgcgatgccgaacctc
gcggcaaggggcgcgtacgcggatgggctgacctactcgccgcaggacctgcaggacata
ctaacctggggccggtcgcgcggcgtggaggtcatcgtggagattgatatgccgggccac
actacctccatcgcggaggcctacccggagctcatcacgggcagggacaagcagccggac
tgggatcagtacgctgcgcaacccccctccggctcacttaagctccgcaaccctgccgtt
aaaaagttcctcaccacactcttcgacgacttactcccaagactcaagtcgcatagccag
tacttccacacgggtggcgatgaggtcaataagaacgtgtacaaatttgacgagaacatc
aaatccaacgactcggccgtgcttcagcccgcgctgcaggacttcctctcgcacgtgcac
accgagttgggccggcacggtgtcacaccctttgtgtgggaggaaatgctgctcgaatgg
aacctgacgcttcccaaggactcgatcgtgcagacctggatctcggaagagagcacgaag
aaggtgatcgagaagggccaccgggtaatcgcggggaactacaacttctggtacctggac
tgtgggcatgggcaatggctggacttccttcccgccagctatgaaacttattacccattc
aatgattactgctcccctaggaagagttggagacacatctactcctacgacccaacagca
ggcctaacccaggaacaagcgaagctagtcctgggcggtgaagtacacgcctggtccgag
cagacagaccccataaactttgacagcgtcgtctggccgcgcgccagtgccgccgccgaa
gtgctctggtccggcaggaccgacgccgccgggaataacaggaccttccccgatgcttcc
ccccgcctcgcagagttcagggagaggcttgtgctccgcggcgtcggcgcgggtccgata
cagcagttatggtgtcatcagcatccggggggttgccagctttaa

DBGET integrated database retrieval system