KEGG   Tuber melanosporum: GSTUM_00006904001Help
Entry
GSTUM_00006904001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tml  Tuber melanosporum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GSTUM_00006904001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GSTUM_00006904001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 561 aa AA seqDB search
MHQMVNPQRHRLLMLSSLSPASSVCLSRTTHSHRRTSQRYLHRATPTSTIESVAVLGSLY
TSCTCGGITGLSTAWYLSKLAPSVPVKLYEKLDRLGGWLNTKRVESEDGTIQFEQGPRTI
RPWTVSGLATIDMIRQLDLEKDLVLISKNTPAAKNRFIYFPDRLNQLPSGLLSLLLSPNL
PVMKGIFTGILAEPFRKRRPADLTDESVGSFISRRFNKTLANNLMSAGLHGIYAGDIDQL
SAKSLFPRFWMAEAHHGSLMKSALSNKVIETEDDQTTRAELHDDNVGICARMQGTSVYSF
RNGIETLSLALARDLEKSPNVTIKLGAKLSSIDYAKPQGLPINIAEGSNKPVSCSHVIST
LFAPSLNSLLPTSLQSPSLASVQAVTVLVVNLYYRTPNLLPVQGFGYLVPKSVPGSENPE
KALGVIFDSDTTPSPGTKVTVMMGGHYWQDRTSYPDKHEAVEMARTVLQRHLRITETPAL
TNVALQKDCIPQYTVGHDERMERAHEDLLTGFDGRLSVAGNSYSGVGLNDCVRNARDVVK
GLLGGRSLTGLEGFKGKRWVS
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaaatggtgaacccacagagacaccgcttgctcatgctctcctctctctctccc
gcttcctccgtttgtctctcgcgaactacgcatagccatcgccgaacctcccaacggtat
ctacatcgcgccacgccgaccagcacaatcgaatcagtcgcagttctcggttcactctac
acctcctgcacgtgtggaggaattaccggtctatctactgcttggtacctctccaagctt
gctccttctgttcccgttaagctgtatgagaagctcgataggctcgggggatggcttaac
actaagcgagtcgaatccgaggatggaactatccagtttgaacagggtcctcgaacaatt
cgcccttggaccgtttctggattggccacaatagatatgatccggcagctggatttggaa
aaggacttagtactcatctcgaaaaacaccccggcagctaaaaacagattcatctacttt
cccgatcgcctaaaccagcttccgagtggtctactctcactattgctgagtccaaacctg
ccagtcatgaaagggatcttcactggtatccttgctgagcccttcagaaagcgccgaccg
gcggatctaacggatgaatcggtgggtagcttcatcagtagacgtttcaacaagacccta
gcgaacaacctcatgtcggcggggctgcacgggatatatgcgggtgacatagatcagctc
agcgcgaagtccctgttcccaaggttctggatggccgaagcgcaccatggaagcctgatg
aaaagtgccctcagtaacaaggtaatagaaactgaagacgatcagaccactcgagcggaa
ttgcacgacgataacgtcggcatttgcgcgcggatgcaagggacgagtgtgtactcgttt
aggaatgggatcgaaacactgagtttagctttggcgagagatctagagaaaagccccaac
gttacaataaagcttggggcgaagttgagtagcattgattatgccaaaccccaagggttg
ccaatcaatatcgctgaagggtcaaacaaacctgtcagctgttcccatgtaatatcgacg
ttattcgctccgtcgctcaattccctcctcccaacatccttgcaatccccctccttagca
tccgttcaagccgtcacagttctagtcgtaaacctttactaccgaacaccaaacctcctt
ccagtccaaggtttcggctacctagtccctaaatccgtcccgggctccgagaatcccgaa
aaagcactcggcgtgatattcgactcggacaccaccccatccccaggcaccaaagtgaca
gtaatgatgggtggacactactggcaagaccgcacctcctacccagacaagcacgaagcc
gtcgaaatggcaagaacagtattgcaacggcacttgagaatcacagaaacaccggcactc
accaatgttgcattgcaaaaggattgcatcccacaatatacggtcggccacgatgagcgg
atggagagagcacatgaggacctgctaacgggatttgatggacgactgagcgtggctggg
aatagctattcgggtgttggattgaacgattgtgttaggaatgcgagggatgtggtaaag
ggcttgctcggtgggaggagcttaactgggttggaaggatttaagggtaagcggtgggtt
tcatga

DBGET integrated database retrieval system