KEGG   Tuber melanosporum: GSTUM_00006995001Help
Entry
GSTUM_00006995001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tml  Tuber melanosporum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tml00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 201 aa AA seqDB search
MHFTKQPPMTGPTKLPPIVLSAPSGTGKSTLLTRLFASHPETFGFSVSHTTRKPRSGEVE
GVEYHFVTPETFESLIERDAFIEHTRFSGNYYGTSVEAVRAVAERGRVCVLDIEMEGVKQ
VKRTDLGAKFVFLKPPSLEVLRSRLEGRGTETEESLGKRLERARVELEFAEVPGVHDKVI
VNDDLDKAYEELEGYILSLIS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcaccaaacaaccacccatgacaggccccaccaaactccccccaatagtcctc
tcggcccccagcggcacgggaaaatccaccctgctgacgcgactattcgcctcgcacccg
gaaaccttcggcttcagcgtctcgcacacaacccggaaaccgcggagcggcgaggttgag
ggcgtggaataccacttcgtcacgcccgagaccttcgagtccctgatcgagcgcgatgcg
ttcatcgagcacacacgcttcagtggcaactactacggcactagcgtcgaggccgtcagg
gccgtcgccgagcgagggcgcgtgtgcgtgctggacatcgagatggagggcgtaaagcag
gtgaaacgcacggatctgggcgccaagtttgtgttcttgaagccgccgagcttggaggtg
ctcaggagtaggcttgaaggcaggggtaccgagaccgaggagagcttgggaaagaggttg
gagagggcgagggtcgagttggagttcgcggaggtgcccggtgtgcatgataaggttatt
gtgaatgatgatttggataaggcgtatgaggagttggaggggtatattttgagtcttatt
tcttag

DBGET integrated database retrieval system