KEGG   Tuber melanosporum: GSTUM_00007006001Help
Entry
GSTUM_00007006001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GSTUM_00007006001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 441 aa AA seqDB search
MPTRDTSAEVGTPDVQTGEKSIATIATLRVGVKLYVYHDNSREHRLAEILSIQTRKGTPH
YYVHYEEFNKRLDEWVPPTRLDLTKETVGDVGTPEDEEADEDSAETDPKATAARAASAKQ
SGTSGTPETFSKEHEIEKLRTSGSMTQSAHEISRVRNLSKLQIGKYEVEPWYFSPYPVEY
TEEEMVFICEFCLSYFGEERRFQRHRTKCTLMHPPGNEIYRDSAVSFFEIDGRRQRTWCR
NLCLLSKCFLDHKTLYYDVDPFLFYIMTTRDEYGCHMIGYFSKEKESAEGYNVACILTLP
QYQRHGYGKLLIAFSYELSKREGKLGSPEKPLSDLGLLGYRAYWQDTIVDLLLNNKGLET
TIDELASMSAMTTQDVIHTLQNLNMLRYFKGQHVICLTDAILSQKQKQVEKQKIKGKRTL
DPELIQWKPPVFTAANRTWNW
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcctacacgcgataccagcgccgaagtcggcacgcccgacgtgcaaaccggagaaaag
tccatcgccaccatagcaaccttacgcgtcggcgtgaagctgtatgtctaccatgataac
tcgagagagcaccgtctggcggagatcttgtcgatacaaacgcgcaagggcacgccacat
tattatgtgcactacgaagagttcaacaagcgtctggacgaatgggtcccacccacacgt
ctagatttgacgaaagagaccgtcggcgatgtgggcacccccgaggatgaagaagctgac
gaggactccgcagagacggaccccaaagccaccgccgcgcgcgccgcttcggcaaagcag
agtggcacgagcggaacgccagagaccttctcgaaggagcacgagatcgagaaactaagg
acttccggctcaatgacccaatccgcgcacgagatctcccgcgtgcgcaatttatcaaaa
ctacagattgggaagtacgaagtggaaccctggtacttctcaccgtacccggtggagtac
acggaagaggagatggttttcatctgcgaattctgcctcagctatttcggcgaggagcgg
cgcttccaacgccaccgaacaaagtgcacacttatgcatcctcctgggaatgagatctac
cgcgactctgccgtctccttcttcgagatcgacgggcggcgtcagcgcacttggtgccgc
aacctgtgcctcctgtcaaagtgcttcctggaccacaagacgctgtactacgacgtcgac
cccttcctcttctacatcatgacgacaagagatgaatacggctgccacatgattggctac
ttctccaaggagaaggagtccgccgagggctacaacgttgcgtgcatcctcacgctcccg
caataccagcgccacggatacggaaaactactcattgccttctcctacgagctcagcaag
cgcgagggaaaactgggatccccggagaaaccactatcagacttgggactactcggctat
cgggcgtattggcaagataccatcgtggacttgttgcttaataataaggggttggaaact
actattgatgagttggcgagcatgagcgctatgactacccaggatgttatccatacgttg
cagaatttaaatatgctgagatattttaaaggtcaacatgtcatctgcctcacagatgca
atcctgagtcagaagcagaagcaggttgagaagcagaagatcaagggtaagagaacgctg
gatccggagctgattcagtggaagccgccggtttttacggcggctaatcggacttggaac
tggtag

DBGET integrated database retrieval system