KEGG   Tuber melanosporum: GSTUM_00007445001Help
Entry
GSTUM_00007445001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
tml  Tuber melanosporum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 524 aa AA seqDB search
MGSTTILNRPQAASALSASPKVVKNNKSLASSSAAPLTYGCNHIEKPLQGPTEGNKMRVL
YGSATRVALDSSRAHAQTCEKCKFLITRTFLCMQCPSIYCPKDAEAHYKEKNHRFGIDSR
SGHVYCFPCQDFIYDPALEKIRVEKEVAMEGGARKRRRLDDIKPSPEDLKYIESNTTLAP
CRATGLRGFLNMGSTCFMSVVLQSLIHNPLVRNFYLADGHKPKECAQANCMSCAMEEVFS
EFFATDKTDGFGPVNLLTTSWKCEQTLAGYQQQDAHEYLQFLLNQLHATNGGNTDTKTEQ
CKCIIHRAFYGNLQSDVTCEGCQNVTTAVDPVMDLSLDLRKKDKRKLATPKTEGDGAMQT
LQECLERFTSTEKLGMNEYNCENCSGHQEVATKQLTVKRLPPVLCIQLKRFEHGSTKSSK
IDTKIRFPMQLDMAPYTTRAKRKAKDGSTDCGPKSSLKGHGPYLYDLLSVVVHTGQINSG
HYINFSRENGQWFRFDDSVVTLATEKDVLSAKAYLLFYIIRSLT
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgggctcaaccaccatattgaatcgcccgcaggctgcttccgcattgtcagcttcacca
aaagttgtcaaaaacaacaaatctctcgctagcagttcggccgctcctttaacctatggt
tgtaaccatatcgaaaagcctctacagggccctacggagggtaataagatgagggtcctt
tacggtagcgccactcgtgtggctttggattcaagccgggcacatgcgcaaacttgtgag
aagtgcaagtttctcataacgagaaccttcctttgcatgcaatgtccgagtatatactgt
cccaaggacgcagaagctcactataaggaaaagaatcaccgttttggtattgactcgaga
agcggccatgtttactgcttcccttgccaggacttcatatatgatccagcattggagaaa
attagggtggaaaaggaggtagctatggaggggggtgctcggaaaaggaggcgattggat
gatatcaaaccctcacccgaagatcttaagtacatcgagtcgaatacaacacttgcgccc
tgcagagctacgggactcagggggtttctcaacatgggatctacctgcttcatgagtgtg
gtattgcagagcctgatacataatccgctggtccggaatttctacttagcagatggtcat
aaacctaaggagtgtgcccaagccaactgcatgagttgcgccatggaggaagtattttca
gagtttttcgccacagataaaacagatgggtttggaccagtcaacctcctcacaacttca
tggaagtgcgagcagacattagctgggtatcaacagcaggatgctcatgaatacctccag
tttctcctgaatcagctacacgcaaccaatggtgggaacactgataccaagacggaacag
tgcaaatgcattatccatcgcgccttctacggtaacctccagagcgatgtgacgtgcgag
gggtgtcagaatgtcacaacagccgtcgacccggttatggacctaagcttggacctgaga
aaaaaggataagaggaagctagccaccccgaagactgagggggatggagccatgcagact
ctacaggaatgccttgaacggtttacaagcacagaaaagctggggatgaatgagtataac
tgcgaaaattgctctggtcatcaagaagtggctacaaagcagttaacggtcaaaagatta
ccaccggtactgtgcattcaactcaagcgttttgaacatggctctacaaaatcatcaaaa
attgacaccaaaatacgattccccatgcagctggacatggccccctatacgacacgcgca
aagcgaaaagcaaaagacggttctacagattgtggtcctaaatctagccttaaaggccat
gggccttacctatacgaccttctcagtgtcgttgtccatacaggccagataaactctggt
cattatataaatttttcacgtgaaaatggacagtggtttcggttcgatgatagtgtggtc
acacttgctactgagaaggatgttctctcagcgaaggcatatctgcttttttacataatc
cggagcttgacctaa

DBGET integrated database retrieval system