KEGG   Tuber melanosporum: GSTUM_00007445001Help
Entry
GSTUM_00007445001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     GSTUM_00007445001
Peptidases [BR:tml01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GSTUM_00007445001
Transcription machinery [BR:tml03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     GSTUM_00007445001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 524 aa AA seqDB search
MGSTTILNRPQAASALSASPKVVKNNKSLASSSAAPLTYGCNHIEKPLQGPTEGNKMRVL
YGSATRVALDSSRAHAQTCEKCKFLITRTFLCMQCPSIYCPKDAEAHYKEKNHRFGIDSR
SGHVYCFPCQDFIYDPALEKIRVEKEVAMEGGARKRRRLDDIKPSPEDLKYIESNTTLAP
CRATGLRGFLNMGSTCFMSVVLQSLIHNPLVRNFYLADGHKPKECAQANCMSCAMEEVFS
EFFATDKTDGFGPVNLLTTSWKCEQTLAGYQQQDAHEYLQFLLNQLHATNGGNTDTKTEQ
CKCIIHRAFYGNLQSDVTCEGCQNVTTAVDPVMDLSLDLRKKDKRKLATPKTEGDGAMQT
LQECLERFTSTEKLGMNEYNCENCSGHQEVATKQLTVKRLPPVLCIQLKRFEHGSTKSSK
IDTKIRFPMQLDMAPYTTRAKRKAKDGSTDCGPKSSLKGHGPYLYDLLSVVVHTGQINSG
HYINFSRENGQWFRFDDSVVTLATEKDVLSAKAYLLFYIIRSLT
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgggctcaaccaccatattgaatcgcccgcaggctgcttccgcattgtcagcttcacca
aaagttgtcaaaaacaacaaatctctcgctagcagttcggccgctcctttaacctatggt
tgtaaccatatcgaaaagcctctacagggccctacggagggtaataagatgagggtcctt
tacggtagcgccactcgtgtggctttggattcaagccgggcacatgcgcaaacttgtgag
aagtgcaagtttctcataacgagaaccttcctttgcatgcaatgtccgagtatatactgt
cccaaggacgcagaagctcactataaggaaaagaatcaccgttttggtattgactcgaga
agcggccatgtttactgcttcccttgccaggacttcatatatgatccagcattggagaaa
attagggtggaaaaggaggtagctatggaggggggtgctcggaaaaggaggcgattggat
gatatcaaaccctcacccgaagatcttaagtacatcgagtcgaatacaacacttgcgccc
tgcagagctacgggactcagggggtttctcaacatgggatctacctgcttcatgagtgtg
gtattgcagagcctgatacataatccgctggtccggaatttctacttagcagatggtcat
aaacctaaggagtgtgcccaagccaactgcatgagttgcgccatggaggaagtattttca
gagtttttcgccacagataaaacagatgggtttggaccagtcaacctcctcacaacttca
tggaagtgcgagcagacattagctgggtatcaacagcaggatgctcatgaatacctccag
tttctcctgaatcagctacacgcaaccaatggtgggaacactgataccaagacggaacag
tgcaaatgcattatccatcgcgccttctacggtaacctccagagcgatgtgacgtgcgag
gggtgtcagaatgtcacaacagccgtcgacccggttatggacctaagcttggacctgaga
aaaaaggataagaggaagctagccaccccgaagactgagggggatggagccatgcagact
ctacaggaatgccttgaacggtttacaagcacagaaaagctggggatgaatgagtataac
tgcgaaaattgctctggtcatcaagaagtggctacaaagcagttaacggtcaaaagatta
ccaccggtactgtgcattcaactcaagcgttttgaacatggctctacaaaatcatcaaaa
attgacaccaaaatacgattccccatgcagctggacatggccccctatacgacacgcgca
aagcgaaaagcaaaagacggttctacagattgtggtcctaaatctagccttaaaggccat
gggccttacctatacgaccttctcagtgtcgttgtccatacaggccagataaactctggt
cattatataaatttttcacgtgaaaatggacagtggtttcggttcgatgatagtgtggtc
acacttgctactgagaaggatgttctctcagcgaaggcatatctgcttttttacataatc
cggagcttgacctaa

DBGET integrated database retrieval system