KEGG   Tuber melanosporum: GSTUM_00007620001Help
Entry
GSTUM_00007620001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
tml  Tuber melanosporum
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSTUM_00007620001
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GSTUM_00007620001
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GSTUM_00007620001
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GSTUM_00007620001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     GSTUM_00007620001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 474 aa AA seqDB search
MPLRAKILRPGFSSQQKMFASSLVIKEQEGDAPHDVLFGSTYGVRTIELNRPGSLNALNG
SMARKIVPRLREWEKSQMANIIILKGAGRALCSGGDVAALVESIKGEGPIGVQKAVRYFE
LEYRLDHLVATYPKPYVAFMDGITMGGGVGLSIHAPFRIATENTLFAMPETKIGFFPDVG
GSFFLPRLDGEIGTYLALTSEGLKGVQAFYSGLATHYIHSTSLPDLEARLAELVFGDYQP
LKERWEIVDSTIEEFVTGLPEDTPIQLSGEIRKAIDRCFRFNTIEKILEALTREDSDWAR
ETFETIKSRSPTSVRVTLRQLRAGKEWTISETFQRELHMATKFLEGKDFVEGVDALLLSK
TSDPKWDPPTLKSSDESVTAPYFTVEEGDRPRLQLLRDESDAGFVDYKQYPHAKIGLPSE
AEVRQLIQERKMLPDDIIPYLVEDRNGKIGLVEKVRDIIDRRVGTGVDRAVWEE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgcctctccgcgcaaagatcttgagacctggcttttcctctcaacaaaagatgtttgcc
tcttctctagtgataaaggaacaagagggggatgcgccccatgacgtacttttcggttca
acatatggagttcgcacgatcgaacttaatcgacccgggtctctgaacgctctgaatggc
tcaatggcacgaaagattgttccccggttacgagaatgggaaaaatcacaaatggcaaac
ataataatcctcaagggcgctggaagggccctatgttctgggggggatgtagcggcactt
gtggagtccattaagggcgaagggccgattggcgttcagaaggcggtaaggtactttgaa
ttggaatacaggctcgaccaccttgttgctacctatcctaagccgtatgttgcgttcatg
gacgggatcacaatgggcggaggagttggattgagcattcatgccccattccgaatcgcc
acggagaatactttattcgctatgcccgagacaaagattggattcttccccgacgtcgga
ggctcgttcttcttgccaagacttgatggggagatcgggacttatcttgctttgacgagc
gagggattaaagggtgttcaggctttttactctggtctcgcgactcactacattcactcc
accagtctaccggacctggaggcgagactggcagagcttgtttttggcgactatcaaccc
ctcaaagagcgttgggaaattgttgatagcacaattgaggagtttgtcactggtttgcca
gaagatacacccattcagctatccggtgaaatccggaaggcaatcgaccgatgtttcagg
ttcaacacaatcgaaaagatcctcgaagcactgactcgagaagactccgattgggcgcgc
gagacgttcgagacaataaagtcccgctccccaacctcggtccgcgtcacgctccgccaa
ttacgcgcgggcaaggaatggaccatctcagagaccttccagcgagagctgcacatggca
acgaaatttttggaagggaaggactttgtggaaggcgttgatgcactgctcctctccaag
acgtcggaccccaaatgggatcccccgactctaaaatcctcggacgagagcgttacagcc
ccttacttcacggttgaggaaggggacagacctcgcttgcagctcctccgcgatgaatcc
gacgccggcttcgtcgattacaagcagtacccgcacgcgaaaattggcctaccgtccgag
gcggaggtacgccagttgattcaggagcggaagatgctcccagatgatatcatcccatac
ctcgtcgaggacaggaacggcaagattggactcgtggagaaggtcagggatatcattgac
aggagagttggtaccggggtcgatcgggcggtttgggaagaataa

DBGET integrated database retrieval system