KEGG   Tuber melanosporum: GSTUM_00007956001Help
Entry
GSTUM_00007956001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tml  Tuber melanosporum
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tml00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GSTUM_00007956001
Enzymes [BR:tml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GSTUM_00007956001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 353 aa AA seqDB search
MKDFCSLFTLASLLLVATASNVIDLTPDNFDKEILQNGRPALVEFFAPWCGHCKSLAPVY
EELADSLASQKDKVAIAKVDADNHKALGKRFGVSGFPTLKWFDGKSADPIPYESGRDLEA
LQAFLKEKVGGLKLKAKREAPSNVIVLSDANFDKIVHDEKKDVLVEFYAPWCGHCKNLAP
IYEKLAKNFASETNVVVAKLDADSPGGKASAEKYGITGFPTLKWFPKGSSAKEPILYESA
RSEEALTQFINKHAGTHRVVGGGVDDAAGRIASLDTIVQKLISGEKDAEKELAKAAEENA
DYPKKEIKRLEGIAAKGGLAPEKLDDILSRKNILTQFLSKENEGEREEVKEEL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatttctgctctctattcacgctcgcttcactcctgctggtcgctacagctagt
aatgtcatcgatttaactcccgataacttcgacaaagagattctgcagaatggaaggccg
gcattggtcgagttttttgctccgtggtgcggacactgcaagagtcttgcccccgtctat
gaggagcttgcggattcgcttgctagtcagaaggacaaagttgcgattgctaaggtcgat
gccgataatcacaaggcactcggaaaacggtttggtgtctccggcttcccaacgttgaaa
tggtttgacgggaagtctgccgatcctattccatatgaatccggtcgggacttggaagca
cttcaagcgttccttaaggagaaagttggcgggttgaagcttaaggctaaacgtgaagcg
ccaagcaatgttattgtgcttagtgacgccaacttcgataagattgttcatgatgagaag
aaggatgtcttggttgagttctatgcgccatggtgcggtcactgcaaaaaccttgctccg
atatacgagaagcttgctaagaacttcgcctccgagactaacgttgtggttgctaaactt
gacgccgactctcctggtgggaaggcctctgctgagaagtatggcatcaccgggttccct
actctaaagtggttccctaaggggtcttctgccaaggaacccatactctatgagtctgca
aggtccgaggaggcattgacccagttcatcaacaagcatgccggtacccaccgtgttgtt
ggtggaggtgttgatgatgcggcaggaagaattgcttccttggacaccattgtccagaaa
cttatttcgggggagaaagatgccgagaaggagttggcaaaggctgccgaggagaatgca
gattatcccaagaaggagatcaagaggttggagggaattgccgccaagggtggtttggcc
ccagagaagttggatgacatcctaagccgtaagaacatcctcacacagtttctctccaag
gagaatgaaggggagagggaagaagtcaaagaagagctgtga

DBGET integrated database retrieval system