KEGG   Tuber melanosporum: GSTUM_00008184001Help
Entry
GSTUM_00008184001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
tml  Tuber melanosporum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GSTUM_00008184001
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSTUM_00008184001
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GSTUM_00008184001
Enzymes [BR:tml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GSTUM_00008184001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 745 aa AA seqDB search
MEAGGSDIIEIGLPFTDPIADGPTIQKANTIALENGMSATTALKVVRDARGKGLKVPVLF
MGYYNPVLSYGEQQLVKDCREAGVNGFIICDLPPEEAVKFRGFCNSEGLSYVPLIAPSTK
PSRLKFLCSIADSFIYVVSRMGTTGASGALNVGLGDLCRRVHVASRNVPIAVGFGVSTRD
HFVSVGQFSEGIVIGSQVINVISQSKPEEINEKVKEYCQMVVGRDGKDSTTREVGIVETM
GKAKEPLDVHPTGVIAEKDVETGPGLMDQLDALNVGSEASPQSIPSRFGEFGGQYVPESL
MDCLAELERGFIEANNDPKFWEEFRSHYPYMGRPGQLHLAENLTKRCGGANIWLKREDLN
HTGSHKINNAIGQILIAKRLGKTEIIAETGAGQHGVATATVCAKFGMKCTVYMGAEDVRR
QALNVFRMKLLGAQVISVEAGSRTLRDAVNEALRSWVVNLSTTHYLIGSAIGPHPFPTIV
RTFQSVIGNETKQQLMEKRGKLPDAVVACVGGGSNCAGMFYPFAKDLSVKMLGVEAGGDG
LDTTRHSATLAGGSKGVLHGVRTYILQNSEGQISDTHSVSAGLDYPGVGPELASWKDSSR
AKFISASDAEAFKGFRALSELEGIIPALESAHAIFGGMELAKTMKPCEDIVICLSGRGDK
DVQSVAEELPSLGPKIGWDLRCELVPSLSDIYTLTLTSLTLNIQKQTPRFLISIFFRRFS
ISPRRSLVWYFMFHFMLRDRKGYVD
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgggggttctgatataattgaaattggcctacctttcaccgacccaattgcc
gatggaccgactattcagaaggcgaatactattgccttggaaaacggtatgtcagctact
acagccttgaaggtagttcgcgacgctcgtgggaaaggattgaaagtcccggtccttttc
atgggatactacaacccggtcttgagctacggcgagcaacaacttgtcaaggattgtcgg
gaggccggtgttaatggcttcatcatttgcgatctacctcccgaggaagctgtaaaattc
agaggattctgtaatagtgaaggtttgagttatgttccgcttatagctccatctacaaag
ccttcccgtttgaagtttctctgcagtatagccgactcattcatatacgttgtttctcgt
atggggacaactggcgcatcgggtgcattgaacgttggccttggtgatctatgtaggcgt
gtacatgtggcatctagaaacgttcccatcgcagtcggctttggagtttccacccgtgat
cacttcgtttcggttggccagttttctgagggtatcgttattggctcacaagtgatcaat
gttatctcccaatcaaaacccgaagagatcaatgagaaagttaaggagtattgccaaatg
gtggttggtagggatggcaaagattcaaccacccgtgaagtcgggatcgtggaaaccatg
ggaaaggccaaagaaccacttgatgtccatcctacaggtgtcatcgctgaaaaggatgtg
gagacaggcccaggcttaatggaccagctcgatgctttgaacgtcggtagtgaagctagc
cctcagtcaatcccttctcgctttggcgaattcggcggtcaatacgtaccagaatcttta
atggattgccttgcagagctagagcgtggctttatcgaagcgaataacgatcctaagttc
tgggaagagtttcggtcgcactacccctatatgggtcgcccagggcaacttcatctagca
gaaaatcttaccaagaggtgcggaggcgccaatatctggttgaagcgagaggacctcaat
cacacaggatctcataaaatcaataatgctatcggacaaattcttattgctaagcggctg
ggtaagaccgagattattgcagaaactggggccgggcagcatggtgtagcaaccgcaact
gtctgtgccaagtttggtatgaagtgcacagtttatatgggcgctgaagatgtgaggcgt
caagccttgaatgttttcagaatgaagcttctaggggctcaggtcatatctgtagaagct
ggatctcgtaccctacgtgacgctgtcaatgaggcgcttcgttcgtgggttgtcaacctt
tcgacaacacattacctgattggatcagccattggcccgcatccgttccctacaatcgtt
cgaaccttccaaagcgtcattgggaatgagaccaaacaacaactcatggagaagcggggg
aaactgcctgacgcggttgtagcttgtgtgggaggtggatcgaattgcgcaggaatgttt
tacccctttgcgaaggatctttcggtaaaaatgttgggtgtagaagctggcggagatggt
ctagatactactagacactcagctacacttgctggtggtagcaagggtgtccttcacgga
gtccgcacttatattcttcaaaattctgaaggtcagatttctgacacgcattccgtttcc
gctgggctagactaccctggagttgggccagagctcgcaagctggaaagatagcagccgt
gcaaagttcatttctgcctccgatgccgaggctttcaaaggctttagagcactctctgaa
ctcgaaggtattattcctgccctcgagagtgcgcacgcaatttttggcggaatggagttg
gcaaagacaatgaaaccttgcgaggatatcgtcatctgtctatccggcagaggggataaa
gacgtccagagcgtcgctgaagaactccccagtcttgggcccaagatcgggtgggatctc
agatgtgagttggttccttctctttcggatatctatacattaacattgactagtctaacc
ttaaacatccaaaaacaaacaccacgttttctcatctcaattttctttcgcagattctct
ataagcccccggcggagtttggtctggtatttcatgtttcattttatgctgagggataga
aaaggttacgtagactaa

DBGET integrated database retrieval system