KEGG   Tuber melanosporum: GSTUM_00008184001Help
Entry
GSTUM_00008184001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
tml  Tuber melanosporum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GSTUM_00008184001
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSTUM_00008184001
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    GSTUM_00008184001
Enzymes [BR:tml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     GSTUM_00008184001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 745 aa AA seqDB search
MEAGGSDIIEIGLPFTDPIADGPTIQKANTIALENGMSATTALKVVRDARGKGLKVPVLF
MGYYNPVLSYGEQQLVKDCREAGVNGFIICDLPPEEAVKFRGFCNSEGLSYVPLIAPSTK
PSRLKFLCSIADSFIYVVSRMGTTGASGALNVGLGDLCRRVHVASRNVPIAVGFGVSTRD
HFVSVGQFSEGIVIGSQVINVISQSKPEEINEKVKEYCQMVVGRDGKDSTTREVGIVETM
GKAKEPLDVHPTGVIAEKDVETGPGLMDQLDALNVGSEASPQSIPSRFGEFGGQYVPESL
MDCLAELERGFIEANNDPKFWEEFRSHYPYMGRPGQLHLAENLTKRCGGANIWLKREDLN
HTGSHKINNAIGQILIAKRLGKTEIIAETGAGQHGVATATVCAKFGMKCTVYMGAEDVRR
QALNVFRMKLLGAQVISVEAGSRTLRDAVNEALRSWVVNLSTTHYLIGSAIGPHPFPTIV
RTFQSVIGNETKQQLMEKRGKLPDAVVACVGGGSNCAGMFYPFAKDLSVKMLGVEAGGDG
LDTTRHSATLAGGSKGVLHGVRTYILQNSEGQISDTHSVSAGLDYPGVGPELASWKDSSR
AKFISASDAEAFKGFRALSELEGIIPALESAHAIFGGMELAKTMKPCEDIVICLSGRGDK
DVQSVAEELPSLGPKIGWDLRCELVPSLSDIYTLTLTSLTLNIQKQTPRFLISIFFRRFS
ISPRRSLVWYFMFHFMLRDRKGYVD
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgggggttctgatataattgaaattggcctacctttcaccgacccaattgcc
gatggaccgactattcagaaggcgaatactattgccttggaaaacggtatgtcagctact
acagccttgaaggtagttcgcgacgctcgtgggaaaggattgaaagtcccggtccttttc
atgggatactacaacccggtcttgagctacggcgagcaacaacttgtcaaggattgtcgg
gaggccggtgttaatggcttcatcatttgcgatctacctcccgaggaagctgtaaaattc
agaggattctgtaatagtgaaggtttgagttatgttccgcttatagctccatctacaaag
ccttcccgtttgaagtttctctgcagtatagccgactcattcatatacgttgtttctcgt
atggggacaactggcgcatcgggtgcattgaacgttggccttggtgatctatgtaggcgt
gtacatgtggcatctagaaacgttcccatcgcagtcggctttggagtttccacccgtgat
cacttcgtttcggttggccagttttctgagggtatcgttattggctcacaagtgatcaat
gttatctcccaatcaaaacccgaagagatcaatgagaaagttaaggagtattgccaaatg
gtggttggtagggatggcaaagattcaaccacccgtgaagtcgggatcgtggaaaccatg
ggaaaggccaaagaaccacttgatgtccatcctacaggtgtcatcgctgaaaaggatgtg
gagacaggcccaggcttaatggaccagctcgatgctttgaacgtcggtagtgaagctagc
cctcagtcaatcccttctcgctttggcgaattcggcggtcaatacgtaccagaatcttta
atggattgccttgcagagctagagcgtggctttatcgaagcgaataacgatcctaagttc
tgggaagagtttcggtcgcactacccctatatgggtcgcccagggcaacttcatctagca
gaaaatcttaccaagaggtgcggaggcgccaatatctggttgaagcgagaggacctcaat
cacacaggatctcataaaatcaataatgctatcggacaaattcttattgctaagcggctg
ggtaagaccgagattattgcagaaactggggccgggcagcatggtgtagcaaccgcaact
gtctgtgccaagtttggtatgaagtgcacagtttatatgggcgctgaagatgtgaggcgt
caagccttgaatgttttcagaatgaagcttctaggggctcaggtcatatctgtagaagct
ggatctcgtaccctacgtgacgctgtcaatgaggcgcttcgttcgtgggttgtcaacctt
tcgacaacacattacctgattggatcagccattggcccgcatccgttccctacaatcgtt
cgaaccttccaaagcgtcattgggaatgagaccaaacaacaactcatggagaagcggggg
aaactgcctgacgcggttgtagcttgtgtgggaggtggatcgaattgcgcaggaatgttt
tacccctttgcgaaggatctttcggtaaaaatgttgggtgtagaagctggcggagatggt
ctagatactactagacactcagctacacttgctggtggtagcaagggtgtccttcacgga
gtccgcacttatattcttcaaaattctgaaggtcagatttctgacacgcattccgtttcc
gctgggctagactaccctggagttgggccagagctcgcaagctggaaagatagcagccgt
gcaaagttcatttctgcctccgatgccgaggctttcaaaggctttagagcactctctgaa
ctcgaaggtattattcctgccctcgagagtgcgcacgcaatttttggcggaatggagttg
gcaaagacaatgaaaccttgcgaggatatcgtcatctgtctatccggcagaggggataaa
gacgtccagagcgtcgctgaagaactccccagtcttgggcccaagatcgggtgggatctc
agatgtgagttggttccttctctttcggatatctatacattaacattgactagtctaacc
ttaaacatccaaaaacaaacaccacgttttctcatctcaattttctttcgcagattctct
ataagcccccggcggagtttggtctggtatttcatgtttcattttatgctgagggataga
aaaggttacgtagactaa

DBGET integrated database retrieval system