KEGG   Tuber melanosporum: GSTUM_00008960001Help
Entry
GSTUM_00008960001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
tml  Tuber melanosporum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    GSTUM_00008960001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     GSTUM_00008960001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 544 aa AA seqDB search
MVDFDVGAFMSSYSPTIGIAFSGGGYRAMLSGAGEFKAMDSRTPGSTAVGNIGGLLQSAK
YIAGLSGGSWLLGSVVINNFTTIAKLQAAGNVWDFENSILAPEGALHIVDTTLYYNDLNR
EVQDKDNAGFDVSLTDYWSRALSRQFVNYTDGGPGITYSSIAKTDRYKNAEMPFPIIVAD
GRNPGETIISSNATVYEYNPLEFGSFDPTLYAFTPMGYIGSNVTNGVPNESGVCARGFDN
VGFVMGTSSSLFNVLITELSSTGLPGVLRKLIETTLNSISAADNDIADYSPNPFFAVNPD
INPSAKTRDLTLVDGGLDGQNIPLHPLIQPIRKVDVIFAMDNSADTRSNWPNGTALIATY
ERSIKGSQSNGTLFPSVPDVNTFINLGLNNRPTFFGCDGRNITSDTNKFPPLVVYIPNSP
YTFNSNISTNQMAYTASERDLMIENGYNIATRGNASFDENWPACVGCAIVHREQERKGQT
QTAQCQKCFKDYCWDGTRNSAVPNDYEPTALVSAKSAGTKNGAKSWGTVIIAVLSGLVSA
VLLL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggtggatttcgatgtaggggcgttcatgagcagctattcgcccactatcggcatcgca
ttctccggcggaggttatagggcaatgctgtcgggtgctggggaattcaaagcgatggat
agtcgaactccggggtcaactgccgtgggaaacattggtggactgttgcagagtgcgaaa
tatattgcgggtttgtcaggcggaagttggctgttgggaagtgtggtgattaacaacttc
accaccatcgccaagttacaggcggcggggaacgtgtgggattttgagaacagcatccta
gctccggaaggggcattgcatattgtggacactactctctactacaacgaccttaaccgg
gaagtgcaggacaaggacaatgctgggtttgatgtcagtttgaccgactactggtcgcgc
gcgctttctcgccagtttgtcaattacactgatggaggtccgggaataacttactcctcg
atagcgaagacagatcggtacaagaacgctgaaatgccgttccccatcattgttgcggat
ggcaggaatcctggggagacgatcatctctagcaatgccacagtctacgagtacaacccc
ttggagtttggatccttcgatcctactctatatgcctttacccccatgggatatatagga
tcgaacgtcaccaacggtgttccgaatgagagtggtgtatgcgctcggggtttcgacaat
gttggatttgtgatgggaacatcttcatccttgtttaacgtcttgattactgaactttcc
tccaccggcttgcccggtgttctgaggaagctcatcgagactaccctgaactcaatctcc
gctgctgataacgacattgcagactattcaccgaatccgttcttcgctgtcaaccctgac
atcaacccctccgcgaagactagagatctgacacttgttgatggtggcctggatggccaa
aacatccctctccacccacttatccaaccaatccgcaaggtcgatgttatctttgcaatg
gataactctgccgacaccagatccaactggcccaatggcacagccctcatcgctacatat
gagcgttcgatcaaaggttcccaaagcaacggaacccttttcccttccgtcccagacgtc
aatactttcatcaacctcggccttaacaaccgcccaacattcttcggctgcgatggccga
aacatcacctcagacacgaacaagttccctccattggtagtttacatccccaactcaccc
tacaccttcaattccaacatcagcaccaaccagatggcatacacagcgtccgagcgtgac
ctgatgatcgaaaacgggtacaatatcgcgacccgcggcaacgcctcctttgacgagaac
tggcccgcctgcgtcggttgcgccatcgttcaccgtgagcaggagcgcaagggacagaca
cagacagcgcagtgccaaaagtgcttcaaggactactgctgggacgggacgcgcaatagc
gctgtacccaacgattacgagcccacggcactcgtctcggccaagagcgctggcacaaag
aatggagcgaagagctggggaacagtcattatcgcggtgttatccgggttggtgagtgct
gtgttgcttttgtaa

DBGET integrated database retrieval system