KEGG   Tuber melanosporum: GSTUM_00008973001Help
Entry
GSTUM_00008973001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tml  Tuber melanosporum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GSTUM_00008973001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     GSTUM_00008973001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 342 aa AA seqDB search
MPDILLLQRRRAIVRESDLHLGDTGSACSGATKFKYFGGDFNQAGAEFAGSVIPGQLGTH
YTWPKTSSIDYFLDLGMNTFRIPFSMERLVPPAQGLAGTMDATYLAALKNIATYITGKGA
HAIIDPHNYGRYNGAIITDTAAFGKWCKNIASEFKSDYNIIFDTNNEYHDMDQELVFNLN
QACINGIRAAGATSQLILVEGNSWTGAWSWVSSGNAASMIDLEDPNDNIAFEMHQYLDGD
SSGTSQNCVSSTIGAERLTATTNWLKHNGKKGFLGEMGAGSNDACIAAVYGALCHMQQAG
GVWIGALWWAAGPWWGNYFQSIEPPDGASISRILPEALMPFV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccggatatactcctactacaacgacgacgagcgattgtacgggaatctgatctccac
cttggcgatactggctctgcgtgctcaggagcaaccaagttcaagtactttgggggtgat
tttaaccaggctggcgctgagttcgctggcagtgttattcccggccaattggggacccac
tacacctggcctaaaactagcagtattgattacttcctcgacctcgggatgaatactttc
cgtattccattctcgatggagaggttggttccgcctgcccaaggtttagctggaaccatg
gatgctacatatcttgcagccttgaagaatattgccacctacatcaccggaaagggagcg
catgctatcatcgatccccacaactacggtcgctacaatggcgcaataattaccgatacc
gctgccttcggtaaatggtgcaagaacatcgccagcgagttcaagtcggactacaatatc
attttcgataccaacaacgaataccacgacatggaccaggagctcgtcttcaaccttaac
caagcttgtattaacggaattcgtgctgccggcgccacttcgcaattgatcttggtcgag
ggcaactcgtggaccggcgcttggtcctgggtttccagtggtaacgcagcaagcatgatc
gacctagaggaccctaacgacaacatcgcattcgagatgcatcaatatcttgacggcgac
tcttccggaacctcccagaattgtgtatcctcaactattggtgccgagagacttaccgcc
actacgaactggctcaaacataacgggaagaagggattccttggtgaaatgggtgctgga
agtaatgatgcatgcatcgccgctgtatatggcgctctgtgccacatgcaacaggccggc
ggtgtctggattggggctctttggtgggctgctgggccctggtggggaaattactttcag
agcatcgagcctccagatggtgcttcgatctctagaatcctcccggaggctttgatgccg
tttgtttag

DBGET integrated database retrieval system