KEGG   Tuber melanosporum: GSTUM_00009055001Help
Entry
GSTUM_00009055001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tml  Tuber melanosporum
Pathway
tml00260  Glycine, serine and threonine metabolism
tml00750  Vitamin B6 metabolism
tml01100  Metabolic pathways
tml01110  Biosynthesis of secondary metabolites
tml01230  Biosynthesis of amino acids
Module
tml_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSTUM_00009055001
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GSTUM_00009055001
Enzymes [BR:tml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GSTUM_00009055001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 9182700
NCBI-ProteinID: XP_002840509
INRA: GSTUM_00009055001
UniProt: D5GJK7
AA seq 545 aa AA seqDB search
MASPTASQRYLSTRGGSYGFTFEAAVLKGLASDNGLFIPEAIPSPPTNWQKTWKTLSFQD
LAYEVLSLYISPDEIPSSDLRELVTRSYSTFRHEDITPLNTILPDANLHVLELFHGPTFA
FKDVALQFVGNLFEYFLVRKNKDVKEGEKRHHLTVIGATSGDTGSAAIYGLRGKRDVSVF
ILHPKGRVSPIQEAQMTTVLDKNVHNLSVVGTFDDCQDVVKALFSHPELSKSHNLGAVNS
INWARILAQIVYYFYSYFTLLRRLPVGSVPIFRYVVPTGNFGDVLAGYYAKKMGLPIDKL
VIATNENDILDRFFRTSRYEKRPVSPEEGEGGPAVGGVKATLSPAMDILISSNFERLLWY
LAYENEIPNATNEDQKRARAGSVLNEWMTSLKNTGTTVVSEDVLNIAKRDFTSERVSDNQ
TVETIRHMFNTPPSASYILDPHSAVGVAASLRLIKASQAAGEENVHHISLSTAHPAKFNH
AVDLALTGISGGEEVGDYDFEKMVRPQEFLGLETREKRVREVERADVELVRQVVVEVLEE
EEVER
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacccaccgcctcgcaaaggtacttgagtacccgtggcgggtcctacggcttc
acctttgaggccgccgtcctcaaaggcctcgccagcgacaacggcctcttcatcccagag
gcaattccatccccacccacgaactggcaaaaaacctggaagaccctctcattccaagac
ctagcttacgaggtcctctcactctacatttccccggacgagatcccctcctcagaccta
cgggagctggtcacacgctcgtattccaccttccgccacgaggacatcacgccactcaat
accatcctcccggatgcaaacctgcacgtcctagagctgttccatggccccacgtttgcg
tttaaagacgttgcattgcaattcgtcgggaacctgtttgagtatttcctcgttaggaag
aataaggatgtgaaagagggggagaagaggcaccacttgacagtgatcggcgctacgagt
ggagataccggatccgccgctatctatggccttcgcgggaagagggacgtatcagtattc
atcctccacccgaagggtcgtgtgagcccgatccaggaagcgcagatgacgacagtgcta
gacaagaacgtgcacaacctcagcgtcgtcggaactttcgatgactgccaagatgtggta
aaagcactcttctcgcatcccgaattgtcaaagtcccacaacctgggcgcagtcaatagc
atcaattgggccaggatcctcgctcagatcgtctactacttctattcctacttcaccttg
ctcaggcgtctgccggtaggaagtgtacccatctttcgctacgtcgtgccaacgggaaac
ttcggtgacgtgttggcgggttactatgctaaaaagatgggcctaccaatcgataagctc
gtcattgcgacaaatgagaacgacatcctggatcgcttcttcagaacaagccgctacgaa
aagcgtcctgtgtccccagaggagggtgaaggtggcccagcagtaggcggggttaaagca
accctttccccagcaatggacatcctcatatcctctaacttcgagcgtctactctggtac
ctagcctacgagaacgaaatccccaacgctaccaacgaagaccagaaacgtgcccgggcc
ggcagcgtcctgaacgagtggatgacctccttaaagaacactggcactaccgtggtctcc
gaagacgtgcttaacattgcaaagagggacttcacttccgagcgtgttagcgataaccag
actgtcgagactatacggcatatgtttaataccccgccttctgcatcttacattcttgat
ccgcattcggccgttggagtcgccgcttccttgagacttattaaggcttcgcaggctgct
ggcgaagaaaacgtccaccatatctcattgtcaaccgcacatccggcaaagttcaatcat
gcagtggatctagcgctcacagggattagtggtggcgaggaggtcggggactatgacttc
gagaagatggtcaggccacaagagttccttggcttagagactagggagaagagggttcgc
gaggtggagagggcggatgtcgagcttgttagacaggttgttgtcgaagtgctagaggaa
gaagaggttgagaggtag

DBGET integrated database retrieval system