KEGG   Tuber melanosporum: GSTUM_00009055001Help
Entry
GSTUM_00009055001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tml  Tuber melanosporum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tml01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tml00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tml00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 545 aa AA seqDB search
MASPTASQRYLSTRGGSYGFTFEAAVLKGLASDNGLFIPEAIPSPPTNWQKTWKTLSFQD
LAYEVLSLYISPDEIPSSDLRELVTRSYSTFRHEDITPLNTILPDANLHVLELFHGPTFA
FKDVALQFVGNLFEYFLVRKNKDVKEGEKRHHLTVIGATSGDTGSAAIYGLRGKRDVSVF
ILHPKGRVSPIQEAQMTTVLDKNVHNLSVVGTFDDCQDVVKALFSHPELSKSHNLGAVNS
INWARILAQIVYYFYSYFTLLRRLPVGSVPIFRYVVPTGNFGDVLAGYYAKKMGLPIDKL
VIATNENDILDRFFRTSRYEKRPVSPEEGEGGPAVGGVKATLSPAMDILISSNFERLLWY
LAYENEIPNATNEDQKRARAGSVLNEWMTSLKNTGTTVVSEDVLNIAKRDFTSERVSDNQ
TVETIRHMFNTPPSASYILDPHSAVGVAASLRLIKASQAAGEENVHHISLSTAHPAKFNH
AVDLALTGISGGEEVGDYDFEKMVRPQEFLGLETREKRVREVERADVELVRQVVVEVLEE
EEVER
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacccaccgcctcgcaaaggtacttgagtacccgtggcgggtcctacggcttc
acctttgaggccgccgtcctcaaaggcctcgccagcgacaacggcctcttcatcccagag
gcaattccatccccacccacgaactggcaaaaaacctggaagaccctctcattccaagac
ctagcttacgaggtcctctcactctacatttccccggacgagatcccctcctcagaccta
cgggagctggtcacacgctcgtattccaccttccgccacgaggacatcacgccactcaat
accatcctcccggatgcaaacctgcacgtcctagagctgttccatggccccacgtttgcg
tttaaagacgttgcattgcaattcgtcgggaacctgtttgagtatttcctcgttaggaag
aataaggatgtgaaagagggggagaagaggcaccacttgacagtgatcggcgctacgagt
ggagataccggatccgccgctatctatggccttcgcgggaagagggacgtatcagtattc
atcctccacccgaagggtcgtgtgagcccgatccaggaagcgcagatgacgacagtgcta
gacaagaacgtgcacaacctcagcgtcgtcggaactttcgatgactgccaagatgtggta
aaagcactcttctcgcatcccgaattgtcaaagtcccacaacctgggcgcagtcaatagc
atcaattgggccaggatcctcgctcagatcgtctactacttctattcctacttcaccttg
ctcaggcgtctgccggtaggaagtgtacccatctttcgctacgtcgtgccaacgggaaac
ttcggtgacgtgttggcgggttactatgctaaaaagatgggcctaccaatcgataagctc
gtcattgcgacaaatgagaacgacatcctggatcgcttcttcagaacaagccgctacgaa
aagcgtcctgtgtccccagaggagggtgaaggtggcccagcagtaggcggggttaaagca
accctttccccagcaatggacatcctcatatcctctaacttcgagcgtctactctggtac
ctagcctacgagaacgaaatccccaacgctaccaacgaagaccagaaacgtgcccgggcc
ggcagcgtcctgaacgagtggatgacctccttaaagaacactggcactaccgtggtctcc
gaagacgtgcttaacattgcaaagagggacttcacttccgagcgtgttagcgataaccag
actgtcgagactatacggcatatgtttaataccccgccttctgcatcttacattcttgat
ccgcattcggccgttggagtcgccgcttccttgagacttattaaggcttcgcaggctgct
ggcgaagaaaacgtccaccatatctcattgtcaaccgcacatccggcaaagttcaatcat
gcagtggatctagcgctcacagggattagtggtggcgaggaggtcggggactatgacttc
gagaagatggtcaggccacaagagttccttggcttagagactagggagaagagggttcgc
gaggtggagagggcggatgtcgagcttgttagacaggttgttgtcgaagtgctagaggaa
gaagaggttgagaggtag

DBGET integrated database retrieval system