KEGG   Tuber melanosporum: GSTUM_00009121001Help
Entry
GSTUM_00009121001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tml  Tuber melanosporum
Brite
Protein kinases [BR:tml01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   GSTUM_00009121001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 2332 aa AA seqDB search
MASPQLDTLGRIFTDIRSKHEEIRQKATNDLKIHLEVVSREHSSEGFARYYAEVNRRVSE
FIHSNDSVDKIGGILALGVLIDVDHDDSTQKTTRYANYLRSIMRGNDNHCMVLAAKTLGQ
LAAPGGTLTSELVESEVKQALEWLQVDRQENRRFASVLLLRELARSSPTLIYGFLSQILD
LIWVALRDPKVLIRETAAEALGVCLGIMKNRDQKNRDQWYAKILEEARSGLRISTTDATH
GSLLIFSQLLDTAGMFMGASYRETCDIVLRLKDNRDHGIRKLTVKMIPCLAKYNPVEFVN
SYLHKFMMHLQTQLKKKDSEDRGAAYKAIGDVALAVGSSMGPYLDHILTSIKDGLTMKGY
FWFLHPASSCISMLATAVGQALTKHMHDLLDLIFACGLSVKLTQALVDLSHYLPPLLPTI
QERLLNMISMVLCGRSFKPLGSPTPPQAPSTAAGKQYRDGQTPEERDAEITLALHTLGSF
DFTNHILNEFVRDIAMKYVEDDNTEVRKAAALTCCQLFVRDPICFQTSNHAIQVVGEVME
KLLTVAIADPDPDIRKTVLLSLDARFDRHLAKAENVRSLFLALNDEIFAIREAAITIIGR
LTLHNPAYVIPSLRKTLIQLLTELEYSSVPRNKEESARLLSHLVAASQKLIRPYVEPMVT
VLLPKARDPSAGVASSILTALGELATVGGEDMVPYIPELMPLIIETLQDQSSPTKRDAAL
RTLGQLASNSGYVIEPYVQYPQLLTILVGIVKTEQNTTLRKETIKLMGILGALDPYKHQT
VERSSEIHLSDQATAVTDVSLIMTGLTPSNEEYYSTVVINSLMNMLKDPSLGQHHSSVID
AIMNIFKTLGLKCVPFLGQIIPGFIAVTRACPTSKLDPYFNQLSILVSIVKQHIRNFLPS
ILALIRDYWESASGLQPTILQLVEAIAHSLEGEFKVYLAQLLPLMLKVLETADPSRPGPS
EKVLHAFVVFGSSSEEYMHLILPVVVRMFEKPGHRIQTRKNRASIIEGNQTGNHELKMTA
LDTLCALVFQLGHDYAHFIPMINKILQVNKIQHTNYELLVSKLLKGEPLPQDLSPDEMYV
YYSPPVSFADFGPKKLPVNQQHLKNAWEASQRSTREDWQEWIRRFSVELLKQSPSHALRA
CAGLAGAYYPLARDLFNAAFVSCWTELYDQYQEELVRSIETALVSPHIPPEILQILLNLA
EFMEHDDKALPIDIRTLGMYAAKCHAYAKALHYKELEFLQEPQSSVIEALISINNQLQQS
DAAIGILRRAQLYNDVPLRESWFEKLQRWEEALKAYQEKEATEPNSFEITMGKMRCLHAL
GEWDHLSQLAQDKWRHAGRDVQRLIAPLAAAAAWGLGQWELMDEYIMVMKEHSPDRSFFG
AILALHRNQFEDAAKHIEKAREGLDTELSALVGESYNRAYSVIVRVQMLAELEEIITYKQ
NTNQPEKQETMRRTWTKRLKGCQRNVEVWQRMLKVRALVISPKENMDMWIKFSNLCRKSG
RIGLAEKSLNSLLPQNESIGSISGTSVPPQVTYARLKFMWATGQQEEAIQHLFDFTDSLS
HDLRVNMTNGHSHGPQQTMTIAIDDEHTRLLARCYLKQGEWQVALHKSWHAEPRTSSRIL
DSYQKATYFHKDWYKAWHAWALANFEVVTAASIPEGRENGRLNSEMIQSHVIPAVSGFFR
SIALSAGSSLQDTLRLLTLWFAHGGNPEVNMAVTDGFNTVSVDTWLEVIPQLIARINQPD
STVRHSIHQLLAEVGRAHPQALVYPLTVAAKSHFSRRQKSAAQIMDSMKAHSPKLVEQAE
IVSQELIRVAVLWHELWHEGLEEASRLYFGDHNIEMMFKTLEPLHDMLERGPETLREISF
HQAFGRDLHEAKECCSAYKRTGEVGDLNQAWDLYYQVFRKITKQLPQLNSLDLQYVSPKL
LGALELDLAVPGTYATGKPVVRIMSFDPTFSVISSKQRPRKLTIKGSDGNPYQYALKGHE
DIRQDERVMQLFGLVNTLLSVDSECFKRHLNIQQYPVIPLSQNSGLLGWVPNSDTLHVLI
REYRDSRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNTTGQDLYRVLWLKSKSS
EAWLDRRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRVTGKVVHIDFGDCFEVAMHREK
YPEKVPFRLTRMLTYAMEVSNIEGSFRTTCEAVMKVLRENKESLMAVLEAFMHDPLMHWR
LGTKESPAEIGPAGMPGENGRRRSIVATLDHPELLRLRNDSSDGDENDSSRKPEAQNERA
LQVLERVKAKLTGTDFKPGEELEISKQVARLIDQATNLENLCQHYIGWCSFW
NT seq 6999 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccgcagctcgacactctggggaggatttttacagatatccgtagcaagcat
gaggaaatacgacagaaggcgacaaatgatttgaagatacacttagaggttgtttctcga
gagcattcaagcgaggggtttgcccggtactatgcggaggtgaatcggcgagtctcggaa
tttatccacagcaatgatagcgtcgacaagattggaggaatccttgctttgggtgtactc
attgatgtcgaccatgacgatagcacacagaagactacacgatatgccaactatttgcgc
agcatcatgcgcggaaatgacaaccactgcatggttcttgccgcgaagactctgggacag
cttgctgcccctggaggaaccttaacttcagagttggtagagagcgaggtgaaacaagcg
ttagagtggctgcaggttgacagacaggaaaatcgacggtttgcttcagtgctgttgttg
agggaactagccagaagctcacctacccttatctacggtttcctcagtcaaatattggac
ttaatatgggtggctttacgggacccaaaggtccttattcgggaaactgccgcggaagcc
ttgggtgtttgcctcgggattatgaaaaaccgcgaccagaagaaccgcgatcaatggtac
gcaaagattttggaagaggcgagatcagggttgagaataagcaccaccgatgccactcac
gggagtcttttaatattttcacagttactcgacaccgctgggatgttcatgggcgcaagt
tatagggaaacttgtgatattgtcttgcgactaaaagataaccgggatcatgggataaga
aaactgactgtgaagatgattccctgtttggccaaatataacccagtggaattcgtcaat
tcttatctccataagttcatgatgcatctgcaaacacagcttaagaagaaagactccgag
gacagaggggcagcatacaaggccatcggagacgtagctttggctgttggcagcagtatg
gggccgtacctcgatcacatactgacaagcatcaaagatggtttaacgatgaaagggtat
ttttggttcttacatcctgcctcatcctgcatcagtatgttagcaactgcagttggtcag
gctttgacgaagcacatgcacgacctcttagacctcatatttgcttgcggtctgagtgta
aagcttacgcaagccctggtcgatctctcccactacctcccccctttactgccgacaatc
caggagagactccttaatatgatcagcatggttctctgtggacgatctttcaagcctcta
gggagccctacaccgcctcaggctccctcaaccgctgccggaaagcaatacagagatggg
caaaccccagaggaaagggatgcagaaatcactcttgctctgcataccttgggaagcttt
gattttactaaccacattttgaatgagttcgttcgtgacattgcgatgaaatacgtcgaa
gacgacaatacagaggtccgcaaagcagcagcattaacttgctgtcaactttttgtccgc
gatcccatatgcttccagactagtaatcacgcaattcaggtcgttggcgaagtgatggag
aagttattgacggtagcgattgctgatccagatccggatatccgaaagactgttttgctt
tctttagatgcccggtttgatagacatctcgccaaggccgagaacgttcgttccttgttc
ttggctctaaatgacgagatttttgcgatccgagaagccgcaattactattatcggcagg
ctcacactccacaaccctgcctacgttataccatcccttagaaagaccctgatacaactc
ctcacggagttggaatattcgagcgtcccccgcaacaaggaggagagtgctagactcctt
agtcaccttgtagcggcgtctcagaagcttatccggccatatgtagagccgatggtcact
gttctccttccaaaagcgagagatccaagcgcaggtgtggcgtcaagtatcttgacagct
ctaggagagcttgctactgttggtggagaggatatggtaccatatatacctgaactgatg
cctttaatcatcgagacacttcaagatcaaagctctccgaccaaacgggatgcagctctc
agaaccctagggcagttggcgagcaactccggatatgttattgaaccatatgttcaatac
ccacagcttctcaccatcttagtcggtatcgtgaagactgagcagaacaccactctgcga
aaagagacgatcaagttgatgggtattcttggagcgttggatccctataaacatcagact
gttgagagaagctcggagatacacctatcagatcaggccactgcagttaccgatgtttcc
ttgattatgacgggccttaccccttcgaatgaagagtactactccactgtggttattaat
tcgttgatgaatatgcttaaggatccctcactcgggcagcaccactcatctgttattgac
gctatcatgaatattttcaaaactctaggactaaaatgtgttccatttctcggacaaatt
atccccggcttcatcgcggttacgcgggcttgcccgactagcaaactggacccgtacttc
aatcagttaagtattttagtctccattgtcaagcaacatatccgaaacttcctccccagc
atcctcgcacttattagggactattgggagtcggcatcgggattgcaacctactatcctc
cagcttgttgaggccatcgcgcattccctagagggggaattcaaagtgtatcttgcgcaa
cttctcccactcatgctcaaagttttagagacagcagatcccagccgccctggcccatca
gagaaggtgctccatgcctttgtcgtatttggttcaagcagtgaggaatatatgcatctc
atcttgcccgtggttgtccgaatgttcgaaaagcctgggcaccggattcaaaccaggaaa
aatcgtgcatccattatcgagggaaatcagacaggtaaccatgagctaaaaatgacagct
ctcgatactctgtgcgctcttgtgttccaacttgggcacgattatgctcatttcattcca
atgattaacaaaattttacaagtgaacaagatacagcacactaattatgaacttcttgtg
agcaaactactgaagggagagccgttgccacaagacttgagccccgacgagatgtatgta
tattatagcccccctgtatctttcgcagactttggaccaaagaagttaccagtaaaccag
cagcatctgaaaaacgcttgggaggcatcgcaacgctcgactcgcgaggattggcaggag
tggatccgtcgatttagtgtggagcttttgaagcaatcaccatctcatgccctgagggca
tgcgctggactggcaggggcatattatcccctggccagagatctttttaacgctgcattt
gtgtcatgttggactgagttatatgatcaataccaggaagaattggttcggtccattgaa
actgcccttgtttcgcctcacattccacctgagatcttgcaaatcctcctgaatcttgcg
gagtttatggagcacgatgacaaagccttacccatcgacataaggactctcgggatgtac
gcggccaagtgtcatgcatatgcaaaagccctgcattataaagaattagaattccttcaa
gagcctcaatcaagcgttattgaggcgctcattagtatcaataatcaactgcagcagtcg
gacgcggcgataggtattctgcggcgagctcagctatataatgacgtccccctgcgtgaa
tcgtggttcgagaagctgcaacgttgggaagaggccctgaaagcttaccaggagaaggaa
gcaactgaacctaattcttttgagataaccatgggtaaaatgagatgtctccatgctctc
ggtgaatgggatcatctctctcaacttgcccaggataagtggcggcatgcgggccgtgat
gtccaacgcttgattgctcctcttgctgctgcggcggcctgggggctggggcaatgggag
ttgatggatgaatacattatggtaatgaaggaacactcgccggataggagtttctttggt
gcgattctcgcactgcataggaatcaattcgaggatgctgcgaaacacatagaaaaggct
agagagggtttagatacggagttgagcgccctggttggcgagagctacaaccgggcatac
agtgtgattgttcgggttcaaatgttggcggaacttgaggagattataacttacaagcag
aacaccaaccagccggagaagcaggagaccatgaggcgcacgtggaccaagcgcctcaag
gggtgtcagcggaacgtagaagtctggcaacgaatgctaaaagtacgggctctcgtgatc
tcgccgaaggagaacatggacatgtggataaagttctcgaatctatgccgaaagtcgggg
aggatagggctcgccgaaaagtccttgaattcattacttccacagaacgagagcattggg
tcgatatcaggcacttctgttcctccacaagtcacttatgcacgcttgaaatttatgtgg
gctaccggacagcaggaggaggctatccagcacttgtttgatttcacagattccctatcc
catgacttaagagtcaacatgacaaatggtcactcccacggccctcagcaaacgatgaca
atagcaattgatgatgagcatacgcgccttcttgctagatgttatcttaagcagggcgaa
tggcaagtagcattgcataagagttggcatgctgagccacggacctcttctagaatcttg
gactcttaccaaaaagcaacttacttccacaaggactggtacaaagcatggcacgcttgg
gcactagcaaattttgaggtggtgacagcagcgtctataccagaaggacgggaaaatggc
cgcctaaattcagaaatgatacaaagccacgtgattcctgccgtcagcggattcttccgt
tcgattgctctttcagctggaagctctcttcaagacactcttagactactcaccctatgg
tttgcgcatggcggcaacccggaagtcaatatggctgtcaccgatggtttcaacactgtt
agcgtggatacttggttggaagtcatcccacagctgattgccaggatcaaccaacctgac
tcgacagtgagacattccattcatcagcttcttgctgaggtcgggagggcgcatcctcaa
gctttagtatacccattgactgttgcggcaaagtcgcatttctcaagacgtcagaagtca
gccgcccagattatggacagcatgaaagcacatagcccgaaactagtcgagcaagcagag
atagttagtcaagagcttatccgagtcgcagtcttatggcatgagctttggcatgaagga
cttgaagaagcttctagactgtactttggagatcacaatattgagatgatgtttaaaaca
ctcgaaccactccatgatatgttggaacggggacctgaaacactgcgagagatctcattc
caccaggcgtttggtagagatcttcacgaggctaaagagtgctgttctgcctacaaacga
accggggaagttggggatcttaatcaggcgtgggatctatactaccaggtattccgtaag
attaccaaacaattaccgcaactcaactctttggacctccaatatgtatcgcctaagtta
ctaggggcccttgagcttgacttagccgtacctggcacatatgcgaccggcaaacctgtc
gtgaggatcatgagcttcgatccgacttttagtgtcatctcatccaagcagaggcccaga
aagttgaccattaagggaagtgatggcaacccttatcaatatgccttgaagggacacgaa
gatatccgccaggatgagcgtgttatgcagcttttcggtctcgtaaataccttgttgtcc
gtggattccgagtgtttcaagaggcatctcaatatacaacaatacccggtcatcccgcta
tcgcaaaattcaggcctacttggatgggtccccaatagcgacaccctacatgtgttgatc
agagaatatcgggacagtcggaagattcttttgaacattgagcatagaatcatgttgcag
atggcccccgactatgacaacttgacacttatgcaaaaagttgaggttttcgggtacgct
ttagacaatactactggacaagatctttaccgagtcttatggttgaagagcaagagctct
gaagcctggcttgatcgccgcacaaactacactaggtccttgggcgtaatgtctatggtt
ggatacattcttgggcttggcgatagacacccgtccaatctaatgcttgaccgtgttact
gggaaagtcgtccacatcgatttcggagattgttttgaggtcgccatgcaccgcgagaaa
tatcctgagaaagtgccttttagacttacgcgcatgttgacctatgctatggaggtcagt
aacatcgaaggtagctttaggacaacgtgcgaagccgtcatgaaagtgcttcgagaaaat
aaggaatccctcatggcagttctagaagcctttatgcacgacccgttaatgcactggcgc
ctcggaacgaaagagagtccagcggaaatcgggccggcaggtatgccaggagaaaacggc
aggcgtcgtagtattgttgctacactagatcacccagaattgctccgacttcggaacgat
tcttcagatggagatgaaaacgactcctcaagaaagcccgaggcgcagaacgaacgcgcc
ctgcaagtgctcgagcgcgtcaaggccaaattaacaggaaccgacttcaaacccggcgag
gaacttgagatctccaaacaggtggcgaggttaatcgatcaggctacaaacctggaaaac
ctttgccagcactatatcggttggtgctcgttctggtag

DBGET integrated database retrieval system