KEGG   Tuber melanosporum: GSTUM_00009184001Help
Entry
GSTUM_00009184001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
tml  Tuber melanosporum
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:tml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    GSTUM_00009184001
Messenger RNA biogenesis [BR:tml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     GSTUM_00009184001
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     GSTUM_00009184001
Translation factors [BR:tml03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    GSTUM_00009184001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 249 aa AA seqDB search
MPETEAPTVVIPDEQRPLDQIPISPPNGEVEEETGEGGLGLPGNKEQLTVFHSPDNFNVK
HPLMNKWTLWYTKPPSNKGENNWNDLLKEVVTFDSVEEFWGIYNNITKTSELSLKSDYHL
FKTGVRPEWEDPQNKNGGKWAYQFRDKRAPIDDLWLNVMLAAIGETLESDKDKEIMGAVV
NVRKALFRVGVWTKTTGGGGGTPEEAALMEIGKKFKEVLKLGVKDFVEFSGHTESAQSGQ
SRVKAKYTV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagaccgaagctccgactgttgtgattcccgacgagcaacgtcctctcgaccag
attcccatctcccctcctaacggcgaggttgaggaggagaccggagagggcggtcttggg
cttcctggcaacaaggagcagcttactgtctttcactctcctgataacttcaatgtcaaa
catcccctcatgaataagtggactctttggtataccaagcctccgagcaataagggagaa
aacaattggaatgacttactcaaggaggttgtcacttttgattctgtcgaagagttctgg
gggatctacaataacataaccaaaacatctgagctcagtttgaaatctgattaccacctt
ttcaagaccggtgttcgccctgagtgggaggatccccagaacaagaatggcggtaaatgg
gcatatcaattcagggataagcgtgctccaatcgatgatctctggcttaacgtcatgctc
gctgccatcggcgagactttagagtccgataaggataaggaaatcatgggcgccgttgtc
aacgttcgtaaggcgctctttagagtcggcgtctggactaagactaccggcggcggggga
ggcactccagaggaagcggccttgatggagattggcaagaaatttaaagaggtcctgaag
cttggtgttaaggattttgttgaattttctgggcataccgagagcgcccaatctgggcag
agcagggtcaaggccaagtatactgtttag

DBGET integrated database retrieval system