KEGG   Tuber melanosporum: GSTUM_00009198001Help
Entry
GSTUM_00009198001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     GSTUM_00009198001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 304 aa AA seqDB search
MEKLYFGSATDNPELTDAQYCTLLSNTKEFGQITPGNSMKWDATEGTRNTFTFAKDEAIL
ALAERNGQKVRGHTLVWHSQLPISNGGFDNATLISIMENHITEVVKKWKGRILHWDVLNE
IFNEDGTWRSSVFYNTIGEAFPGIAFRAARAADPSAKLYINDYNIDGTGAKSTAMYNLVK
KLLAEGVPVDGIGVQAHLIVGNVPSTMQNNWARFASLGVDIAITELGIRMTFPADAAGLS
QQADDYKNVATACINVPRCIGISRFHPYKYSWIPAIFPGQGAALPWDEDMVVKPAYAAIA
GALT
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagctctacttcggttctgcaaccgataatccagagctcactgatgcccaatac
tgtactctcttgagcaacaccaaagaattcggacaaatcactcctgggaatagtatgaag
tgggatgctacagagggcacaaggaacactttcactttcgctaaggatgaagcaatctta
gcactcgccgaaaggaacggtcaaaaggtccgaggacatacattagtctggcactcccaa
cttcctatcagcaacggtggctttgacaatgcaaccctaatctccataatggaaaaccac
atcacagaggtagtgaaaaagtggaaaggccgaatccttcactgggatgtgctgaacgaa
atcttcaacgaggatggcacttggaggtcatccgttttctacaataccatcggtgaagcc
ttcccggggatcgccttccgcgctgcccgggctgcggatccgtccgcgaagctatacatc
aacgactacaatatcgacggcaccggagcaaagtccacggcgatgtacaacctggtcaag
aagcttctcgctgagggcgtacccgtggacgggatcggcgtgcaggctcacttgatcgtc
ggcaacgtgccgagcacgatgcagaacaactgggcgcggttcgcctcgttgggtgtagat
attgccatcactgagttgggtattcgcatgacgtttccggcggacgcggcggggttgtcg
cagcaggctgatgattataagaatgttgctacggcatgcattaatgtgcctaggtgcatc
ggtattagtaggtttcacccatataaatactcgtggattcccgcgatctttcccggtcag
ggcgctgcgcttccttgggacgaggacatggttgtgaagccggcatatgcggctatcgct
ggggcgcttacctaa

DBGET integrated database retrieval system