KEGG   Tuber melanosporum: GSTUM_00009355001Help
Entry
GSTUM_00009355001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tml  Tuber melanosporum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSTUM_00009355001
   01230 Biosynthesis of amino acids
    GSTUM_00009355001
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTUM_00009355001
   00030 Pentose phosphate pathway
    GSTUM_00009355001
   00051 Fructose and mannose metabolism
    GSTUM_00009355001
   00052 Galactose metabolism
    GSTUM_00009355001
  Energy metabolism
   00680 Methane metabolism
    GSTUM_00009355001
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GSTUM_00009355001
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GSTUM_00009355001
Protein phosphatases and associated proteins [BR:tml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSTUM_00009355001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 737 aa AA seqDB search
MNAAVRAVVRMSIAQGCEAYAIYEGYEGLVQGGGLIKRMHWEDVRGWLSEGGTLIGTARC
KKFTERAGRLQGAKNLVLAGIDALVVCGGDGSLTGADIFRSEWPGLLAELIELGELAEEQ
CSPFKTLNIVGLVGSIDNDMSSTDATIGAYSSLTRICQAVDFIDATAYSHSRAFVVEVMG
RHCGWLALMAGLSTGADFVFLPEKPPQDKWEGEMCRIIKTHRTAGKRKTIVIVAEGAIDR
ELKPITATYVRDILVDELRLDTRITTLGHVQRGGTACAFDRILATLQGGEAVRAVLESTP
DTLSPMIAINENKITRKPLMDAVRLTKAVAECIKNKDFAGAMNLRDPEFEEYHRAYMVTT
KPDELSEKAPQDKRMRIAIIHVGAPAGGMNAATRAAATFCLNRGHRPFAIHNGFPGLVRH
DSVRELNWLTVEGWAIRGGSEIGTNRSLPSEDMGMVAWYFQRYKFDGLLIIGGFEAYHAL
TELHSARDSYPAFRIPMICLPATISNNVPGTEFSIGSDTCLNALIEYCDAIKQSASASRR
RVFVVECQGGKSGYVATMAGLSVGALAVYTPEEGINLNMLKDDIDHLRESFANDKGMNRA
GKLILRNEKASKTYTTEIIASIIREEANGRFESRTAIPGHVQQGGTPSPMDRVRAVRLAV
KCIQFLESNKKAPKEVFKDPSTSAVIGVRGASVVFTSIEDLRGAETDWDSRRPRKAFWLD
YRGLVNTLGGRAGTPTG
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagcggttagagcagtggtcaggatgagcattgcacaaggatgcgaggcctat
gcgatctatgagggatatgagggattagtacagggcggggggcttattaagagaatgcat
tgggaggatgttcgtggttggctctccgagggcggaaccttgattggaacagccagatgc
aagaaatttacggaacgcgcaggcagattacagggtgcaaagaatttggtcttggctgga
attgatgctcttgttgtttgtggtggtgatggttctctgactggagccgatatcttccgt
agcgaatggcctggattattggcggaattaatcgagctgggagagctcgctgaggagcag
tgctcacctttcaaaaccctcaacattgttggtttagtagggagtattgataatgacatg
tcttctacagatgctaccattggcgcttatagttctcttacgagaatttgtcaagcagtg
gatttcatcgacgctacagcctatagtcactctcgggcctttgttgtggaagttatggga
aggcattgtggctggctggcattaatggctggattgagcaccggcgccgattttgttttc
ctaccggaaaaaccaccccaagacaaatgggaaggggagatgtgtcgaattattaaaaca
catcgtacggcaggaaaacgcaagaccattgtcattgtggccgaaggtgctattgataga
gagttgaagccaattacagcgacttatgttcgagatatccttgtagacgagttgagattg
gataccagaatcacgactcttggtcacgttcagcgtggtggaactgcctgtgcattcgac
aggattcttgctacgttacaaggcggagaggccgttagagctgtattagagtctactcca
gataccctgagtccgatgattgcaatcaacgaaaacaaaattacccgaaagcctctaatg
gatgctgttagactgaccaaagctgtggcagaatgtataaaaaacaaagatttcgcgggg
gccatgaacctgagagacccggaatttgaagaataccaccgggcctatatggttacgaca
aagccagatgagctttcagagaaagcgcctcaggacaagagaatgaggattgcgatcatt
catgttggagcaccggcaggagggatgaacgcagctacacgtgcggcagctactttttgt
ctcaatagaggccatcgcccgttcgctatacacaatggattccccggcctggttcgccat
gactccgttcgggagttgaactggcttacagtcgaaggctgggccattcgtggcggctct
gagattggaactaaccgctctttgccatctgaagacatgggcatggttgcatggtacttc
cagcgatacaaatttgacggtctcctcattattggtggctttgaagcataccatgcgctc
actgagctccatagtgctagggatagttatcccgccttcagaattcctatgatttgtctg
ccagctactattagcaataatgtccctggaacagaattttcaattggaagcgatacttgc
ttgaacgcacttattgagtactgtgatgctatcaaacagagtgcaagtgctagcagaagg
agggtattcgtcgtcgaatgtcaaggaggaaagtctggttatgtggctactatggctgga
ctctcagttggtgcgctggctgtatacacacccgaagaaggtataaatctcaatatgttg
aaggatgatattgatcaccttcgagagagttttgcgaacgataaaggaatgaatagggct
ggcaagttaatcttgagaaacgagaaagcgtctaagacctataccactgaaataattgct
tcaattatccgcgaggaagcaaatggtcgatttgaatcccgtactgctattcctggacac
gtccagcaaggtggtactccatctcctatggatcgtgtccgggcggtaagattggccgtc
aagtgcattcaatttcttgagtcaaataagaaggctcccaaagaggttttcaaagaccca
agcacaagtgcagtcatcggtgttaggggagcaagtgtcgtgtttacttcaattgaagat
cttcgcggggctgaaactgattgggattcaagaagaccaagaaaggcattctggctagac
tataggggcttggtaaacaccctcggcggacgtgctggaacaccgacgggttag

DBGET integrated database retrieval system