KEGG   Tuber melanosporum: GSTUM_00009423001Help
Entry
GSTUM_00009423001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K03934  
NADH dehydrogenase (ubiquinone) Fe-S protein 1 [EC:1.6.5.3 1.6.99.3]
Organism
tml  Tuber melanosporum
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:tml00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 740 aa AA seqDB search
MMLQGLLRSLKPSGRLLATSPAPRRTFSSTLRAFDEVEITIDGKKVKIEAGAALIQACEK
AGVTIPRYCYHEKLMIAGNCRMCLVEVERVPKPVASCAWPVQPGMLVKTNSPVVHKAREG
VMEFLLANHPLDCPICDQGGECDLQDQSMRYGADRGRFHEIGGKRAVEDKNIGPLIKTSM
NRCIHCTRCIRFANDVAGAPELGSTGRGNDMQIGTYLEKNLDSELSGNVIDLCPVGALTS
KPYAFRARPWELKPVESVDVLDALGSAIRVDARGMEVMRVIPRLNDDVNEEWINDKTRFA
CDGLRTQRLTMPLVRRDDKFIPATWEQALAEVASAFQRLQPKGDEVKAIAGHLVEAESLV
ALKDMINRLGSENLALDQPLGNQPPAHGVDIRSNYLFNSKICGVEEADAILLVGTNPRHE
AAVLNARIRKQWLRSDLEIGLVGENFDNIFHIEHLGQDATSLKKALAGKFGQKLLVAKRP
MIIVGSGVTEHTDGKAFYEIIGQFVDKNAGKIISPEWNGYNVLQRAASRAGAYDIGFVSS
SPTISQTTPKIIWLLGADEITPNDIPKGAFVVYQGHHGDVGAQYADVVLPGAAYTEKSGT
YVNTEGRAQLTRAATGPPGVAREDWKIIRAASEFLGVTLPYDSLAGLRTRMEGISPALTH
YDVVEPASLATVGNKVQIVDANKGAEAGGAPLRRVIENFYFTDAISRSSPTMSRCSAAKM
TRSGIEADPSPGDAAYAASG
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgatgcttcaggggttattgcggagcctgaagccttcgggccgacttctcgcaacttca
ccggcgccacgaaggaccttctcctccactctacgagcctttgacgaggtggaaatcacc
attgacggaaaaaaggtcaaaattgaggctggagcggctctgattcaggcttgcgagaag
gcgggggttactatcccccggtattgctatcatgaaaagttgatgattgctggaaattgc
cgtatgtgcttggttgaggttgagagggtgcctaagccggtggcgtcttgtgcttggcct
gtacaacctggtatgctagtcaagactaactctccagtagtacacaaagctcgagaggga
gtaatggaattcttgcttgccaaccacccactggactgccctatctgcgaccaaggaggt
gaatgcgacttgcaggatcagtcaatgcgctatggcgctgacagaggccgcttccatgag
attggcggaaaacgtgctgtggaggataagaatattggacctcttatcaagacatctatg
aatcgctgcattcactgtacccgctgtattcgattcgccaatgatgttgccggtgctccc
gaacttggatctactggaagagggaatgacatgcaaatcggtacttatttggagaagaat
ctcgactcggaactctcaggaaacgttatcgatctttgccctgttggagccttgacctcg
aagccctacgctttccgtgcgaggccttgggagctaaagcctgtcgaatcagttgacgtg
ctcgacgccttgggatcggctattcgtgtggacgctagggggatggaagtcatgcgtgtt
attcctcgattgaacgatgatgttaacgaggaatggattaatgataagacccgttttgct
tgtgatggacttaggacccagcgattgactatgcctttggtaaggagggacgacaagttc
attccggctacttgggaacaagcgctcgcggaggttgcgtcggcctttcagaggcttcag
cctaagggcgatgaggtcaaggctattgctggtcaccttgttgaggcagagtctttggtg
gcgctcaaggatatgattaacagacttgggtcagagaatctcgctcttgaccagccgctt
ggaaaccaacccccagcacacggtgtcgatattcgctctaactatctatttaactctaag
atctgcggtgtagaggaagcagatgccatactccttgtgggaaccaatcctagacacgag
gccgcggttttgaacgctagaatcaggaaacaatggctccgatctgaccttgaaattgga
cttgttggtgagaactttgacaacatatttcatatcgagcatcttggccaggacgccact
tccctgaagaaagctctagctggaaaatttggccagaagctgctagttgccaagaggccc
atgattatcgtaggtagcggagtcacagagcacacagacggaaaagccttctacgagatc
attggtcaattcgtagataagaatgccggcaagatcatttctccagaatggaatgggtac
aacgttctccaacgtgccgcctcccgcgccggggcctacgacatcggtttcgtctcatcc
tcccccacgatctcccaaaccacgcccaagattatctggctcctaggtgccgacgagata
acccccaacgatatccccaagggcgccttcgtggtctaccaaggtcaccacggcgacgtc
ggggcccaatacgcagacgtggtcctccccggtgcggcctacaccgaaaagtccgggaca
tacgttaacacagaaggccgtgcccaactaaccagagcagcaaccggccctccgggcgtc
gctcgcgaggactggaaaatcatccgtgcggcgagtgagttcttgggcgtcactttgccc
tacgattctttggccgggttgaggactcgcatggaggggatctcaccggcgctgacacac
tacgacgttgttgagcccgcgtccctcgctacggtgggcaataaagtgcagatagttgat
gcgaataagggcgcagaggccggtggggcaccgttgaggagggtaatcgagaatttctac
tttacggatgccatctccaggagctccccgacaatgtccagatgctccgctgcaaagatg
actaggagtggtatcgaggcagatcccagccctggagacgcggcgtatgccgcaagtggg
taa

DBGET integrated database retrieval system