KEGG   Tuber melanosporum: GSTUM_00009440001Help
Entry
GSTUM_00009440001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tml  Tuber melanosporum
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GSTUM_00009440001
  Lipid metabolism
   00062 Fatty acid elongation
    GSTUM_00009440001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     GSTUM_00009440001
Lipid biosynthesis proteins [BR:tml01004]
 Fatty acid synthase
  Component type
   GSTUM_00009440001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 315 aa AA seqDB search
MISPPIISLLVSAGVGIATPMGRPLPLVIWHGLGDAYDSEGIQSVGNLAQQVHPGTFVHS
IYLDQDSDADRSATFFGQVDGQIASVCSQLSTIPELSSGFNAIGFSQGGQFLRGYIQRCN
DPPVKTLITLGSQHNGIADFLAECKPTDFVCRTASSALRSSKWTPWVQNRVVPAQYFRDP
EDLSAYLEHSAFLADINNERPGERNKTYAENLASLEGFVMLMFEDDTTVVPKESAWFAEF
NKTTGERTLVEDRELYKQDWIGLKELGDRKRLEFLTAPGRHMELSDELLTGLFKKYLGGK
VNVEKMELQVQGVEL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatttctcctcctattatatctttgctcgtgtctgccggcgtggggattgccacgccg
atgggacgtccgctgcctttggtcatctggcatggtcttggcgatgcatacgactcggag
ggaattcaaagcgttggaaatctagcacaacaagtccacccgggcaccttcgttcactca
atctacctagaccaggattcagacgcggaccgctcagcaaccttcttcggccaagtcgac
gggcagatcgctagcgtctgctcgcaactctccacaatcccggaactctcatcaggtttc
aacgccatcggcttctcgcaaggtggccaattcctccgtggctacattcaacgctgcaac
gacccgcccgtgaaaacacttataaccctcggcagccagcacaacggcatcgcagacttc
ttagcggaatgcaagccaacagatttcgtctgccgaaccgcgtcatccgcactccgctcc
agcaagtggaccccctgggtgcagaaccgcgtagtacccgcacagtacttccgggatcca
gaggatctaagtgcgtaccttgagcattctgcctttctcgccgatatcaataacgagcgc
cccggcgagcgcaacaaaacttacgcagagaatctggcgagcctggaggggttcgtcatg
ctcatgtttgaagacgataccaccgttgttcccaaggagagtgcctggttcgccgagttc
aataagactaccggggaaagaactctcgtagaggatagggagctgtataagcaggattgg
atcggcttgaaggaattgggggatcggaagaggttagagtttctgaccgcgcctgggagg
catatggagttgagcgatgagttgttgacggggcttttcaagaagtacctcggcgggaag
gttaacgtggagaagatggagctgcaggtgcagggtgtggagctttga

DBGET integrated database retrieval system