KEGG   Tuber melanosporum: GSTUM_00009440001Help
Entry
GSTUM_00009440001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tml  Tuber melanosporum
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tml01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:tml00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 315 aa AA seqDB search
MISPPIISLLVSAGVGIATPMGRPLPLVIWHGLGDAYDSEGIQSVGNLAQQVHPGTFVHS
IYLDQDSDADRSATFFGQVDGQIASVCSQLSTIPELSSGFNAIGFSQGGQFLRGYIQRCN
DPPVKTLITLGSQHNGIADFLAECKPTDFVCRTASSALRSSKWTPWVQNRVVPAQYFRDP
EDLSAYLEHSAFLADINNERPGERNKTYAENLASLEGFVMLMFEDDTTVVPKESAWFAEF
NKTTGERTLVEDRELYKQDWIGLKELGDRKRLEFLTAPGRHMELSDELLTGLFKKYLGGK
VNVEKMELQVQGVEL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgatttctcctcctattatatctttgctcgtgtctgccggcgtggggattgccacgccg
atgggacgtccgctgcctttggtcatctggcatggtcttggcgatgcatacgactcggag
ggaattcaaagcgttggaaatctagcacaacaagtccacccgggcaccttcgttcactca
atctacctagaccaggattcagacgcggaccgctcagcaaccttcttcggccaagtcgac
gggcagatcgctagcgtctgctcgcaactctccacaatcccggaactctcatcaggtttc
aacgccatcggcttctcgcaaggtggccaattcctccgtggctacattcaacgctgcaac
gacccgcccgtgaaaacacttataaccctcggcagccagcacaacggcatcgcagacttc
ttagcggaatgcaagccaacagatttcgtctgccgaaccgcgtcatccgcactccgctcc
agcaagtggaccccctgggtgcagaaccgcgtagtacccgcacagtacttccgggatcca
gaggatctaagtgcgtaccttgagcattctgcctttctcgccgatatcaataacgagcgc
cccggcgagcgcaacaaaacttacgcagagaatctggcgagcctggaggggttcgtcatg
ctcatgtttgaagacgataccaccgttgttcccaaggagagtgcctggttcgccgagttc
aataagactaccggggaaagaactctcgtagaggatagggagctgtataagcaggattgg
atcggcttgaaggaattgggggatcggaagaggttagagtttctgaccgcgcctgggagg
catatggagttgagcgatgagttgttgacggggcttttcaagaagtacctcggcgggaag
gttaacgtggagaagatggagctgcaggtgcagggtgtggagctttga

DBGET integrated database retrieval system