KEGG   Tuber melanosporum: GSTUM_00009492001Help
Entry
GSTUM_00009492001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tml  Tuber melanosporum
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:tml04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:tml04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:tml04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 793 aa AA seqDB search
MMPSIPQPHVIAHFRSLVWQSLDNDMLPTALFAAERLNAYDPKGGDSVHLLGLCLYRDGQ
YLAAESLTESWVRHLGCAYIYAQCCLKLGDGRESQGINALETCRRLWNGTSTWNQHSDTA
RRSIPDAATVHFLLGRLWHNAGDVKKSVDSYVAALKLNPFAWEAFTGLCDTGILSRNYPF
EGSYANDRLGVNLRPNAVFKQSQEMLESLKMPSYPSQPSNIPATIPEESSGLNGLRNSSE
NLPSDPFSSNGGSSRDRSDLSYNNHPSFFNRLNEGVGSSLEAETPTSQPTGSSSHELFGG
ANGVNVTDKPPPVRKTRATTTEITTRKLTSRSTREVGNDGKRSAASSQESGPQAPARRST
RLTSKFTSKLGVGTERETRLGTKEREREAKKARTVANRSRSLHLTGTSASAKERQKERER
ENSEDINMSDATSKPTFAPGHQIDIKKQEAQLFILDLFKKAGAGYFSLSRFRCKEALHAL
NSLPLSQKDTPWAQSQLGRAYYEMANYIEAERCFLRVRHLSPVRTRDMEVFSTILWHQRK
EVDLSYLAHELVELDRLSPEAWCALGNCFSLQRDHDQALKCFKRATQLNPKLAYAFTLQG
HEHVSNEEYEKALASYRSAITADSRHYNAWYGLGKVFEKMGKFDTAEKHFRTASKINPTN
AVLVCCVGMVMEKNKDFRGALHQYNIACEMSPTSALSRFKKARTLMLLKSYQPALKELRV
LKDLAPDEANVHYLLGRLHKLLHDKKSAIKHFTIALNLDPKAGHLIKEAIENLDEDEEDE
YSGDAEENRFLDH
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgatgccctcgataccacagcctcatgttatcgcgcactttcgttcgctggtgtggcaa
tctctagacaacgatatgctgccgacagcactgtttgctgccgagaggttaaatgcttat
gacccgaaaggcggtgactcggttcatttattgggcttatgtttataccgggatggccaa
tatctagcagcggagtcattaacagagagctgggtccgacatctaggctgtgcatatatc
tatgcccaatgctgcttaaagcttggagatggcagagaaagccagggtataaatgccttg
gaaacctgtaggcggctttggaacgggactagcacatggaatcagcattcagatacagcc
aggcgctcgataccagatgctgcaacagtacactttctattgggcaggttatggcacaac
gctggtgatgtgaaaaaatcggtggattcatatgtagcagctcttaaactgaatccattt
gcgtgggaggcgtttaccggtctttgcgacacaggcattttatccagaaattaccccttt
gagggatcgtatgctaacgataggctaggtgtaaacctacgacccaatgccgtgtttaag
caatcgcaagaaatgctcgagtcactcaagatgccttcatatccttcacaaccctcaaat
atacccgccacaatcccagaagagtcatcgggtctgaatggtttgcgaaattcatctgaa
aatttacccagtgatcctttttcgtccaatggggggagcagtagagaccgctcggattta
tcctacaacaatcatccatcattttttaacagattgaatgaaggggtgggtagtagtttg
gaggcggaaaccccaacatcgcaaccaacagggtcaagttctcatgaattatttggagga
gcgaacggtgttaatgttaccgacaaaccaccaccagttcggaagacccgggcgactacc
actgagattactacaaggaagcttacaagccgaagcactcgtgaggtcggtaatgacggt
aagcggtctgcagcatcttctcaggagtcaggacctcaagcacccgctagaaggagtaca
agactcacaagcaaatttacaagcaagttgggtgttggaacagagagggaaactagattg
ggaacaaaggagagggaacgggaagccaaaaaagcaaggactgtagccaatcgaagccga
agtctgcatctaacgggaacttctgcttctgcaaaagagcggcaaaaggagagagagcgg
gagaacagtgaagatatcaatatgtctgatgctacatcaaaaccaacctttgcgccgggg
catcagattgatataaagaagcaggaagcgcagttatttatacttgacctattcaagaaa
gctggtgctgggtatttcagtctgagcagatttcgatgcaaggaagctcttcatgcgtta
aactcgctacccttgagtcaaaaggataccccttgggcccaaagccagcttggaagagca
tactacgaaatggctaactatattgaggctgaaagatgcttcttaagagtacgccatttg
agccccgttcgaacccgggacatggaagtattttcaacaattctctggcaccagcgtaag
gaagtagatctttcttacttggcgcatgagttggttgagcttgaccgactttcgccagag
gcttggtgtgcgcttggtaactgcttttctctacagcgagatcatgaccaagctttgaaa
tgcttcaaaagagcaacacaacttaatccgaaattggcgtatgcctttacacttcaaggg
catgaacatgtgagtaatgaggagtacgagaaggctcttgctagctatcgaagcgcgatc
accgccgatagtaggcattacaacgcatggtacggtcttgggaaagtatttgagaagatg
ggtaagttcgacactgcagagaagcatttccggacagcatcgaagataaatcctacgaat
gctgttttggtgtgttgtgttgggatggtgatggaaaagaacaaggattttaggggagca
ttgcaccagtataacattgcctgtgaaatgtcacctacaagcgcactctctaggttcaaa
aaggcacgaactttgatgttgctcaagagctaccagcctgctcttaaagagctacgggta
ttaaaagatctcgcgccagatgaagccaatgtccattaccttctggggagattgcataaa
ttgctccatgacaagaaaagtgccattaaacatttcaccattgcccttaacctagatcca
aaggccggtcatttaataaaagaagctattgagaaccttgacgaggacgaagaagacgag
tattcgggtgacgcggaagaaaaccgttttctggatcattaa

DBGET integrated database retrieval system