KEGG   Tuber melanosporum: GSTUM_00009565001Help
Entry
GSTUM_00009565001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
tml  Tuber melanosporum
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:tml03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:tml03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 422 aa AA seqDB search
MDDTIYSTSTQHRLFTFTPKQLSDLRYATNKAAIEKITESIKRRAVAAGIVESEIEEIDC
PTAEEELKLVAYYCVKCMQLSDHFQFPSNVKATALTFLHRLYLTTSTLTLHPKKLLLPIL
YLATKTENHYTPIKNFIATAATAGPKVTKEDLLDPEFTIAMGLRWAFQVWHPFRGLEGIF
LELNAIASGRYQPPKPKEHLVLPATEAKVALLELLAGDTDRIGRAHGEARRLLTTTALLT
DVYFLYTPPQISFGAFLEADRELATFYLDIKFPETDVPGRKTKMKLLDVLDEIAKNHLSA
GLSEDLKNPYQGLLLQLPQNGITTSLSMSVDPTLVKEVTRIDKKLYRVTKRDQDSAGKKK
AEEWNGSGSQSGTGSGNGIGRYDEDEERRAKKRRLEREKAEREGDVFGARLPDVKTAGAG
SF
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaccatatactcgacaagtacacaacataggctgttcaccttcacgccaaag
cagctctcggacctacgctatgccaccaacaaagccgcgatcgagaagatcacagagtcg
ataaagcgacgggcggtcgcagcggggattgtcgagtcggagatcgaagagatcgattgt
ccgacggcggaagaggagttaaagctagttgcatattattgcgtgaaatgtatgcagttg
tcggatcattttcagtttcccagcaacgtcaaggcgaccgcgctaacattcctccatcgc
ctctacctaacaacatccaccctcaccttgcacccaaagaagcttctcctaccaatctta
tacctagcaacgaagaccgagaatcactacacgcccataaaaaacttcatcgcgacggcc
gccacggccggccccaaagtgacgaaggaagacctcctggaccccgaattcacaatagca
atgggcctacgctgggccttccaagtctggcaccccttccgcggcctggagggcatattc
ctggaactcaacgcgatagcatcgggccgctaccaaccgcccaaacccaaggaacacctc
gtcctgcccgccacggaggccaaagttgcactgctggagctcctggcgggggacacggac
cggatcgggcgagcgcacggggaggcgagaaggctgctgacaacaactgccctcctgacg
gacgtgtacttcctctacacccccccgcagatcagcttcggcgccttcctagaagcagac
agggagctcgctaccttctaccttgacattaaatttcccgaaaccgatgtgcccgggaga
aagaccaagatgaagctcttggacgtgctggacgagatcgccaagaaccacctctctgct
ggcctatctgaggacttgaaaaatccttatcagggcttactcctccagttgcctcagaat
ggaatcaccacttcactctctatgtccgtggaccctacgctcgtcaaggaagttacgagg
atcgacaagaagctctaccgtgtcactaagagagaccaggacagcgctggaaagaagaag
gcggaggagtggaatgggagtggtagccagagtggtactgggagtggcaatggtattggg
aggtacgatgaggacgaggaacgccgtgccaagaagcgcaggctagagagggagaaggcg
gagcgtgaaggggatgtcttcggcgcccgcctgccggatgtcaagactgcgggtgcgggg
tctttttag

DBGET integrated database retrieval system