KEGG   Tuber melanosporum: GSTUM_00009565001Help
Entry
GSTUM_00009565001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
tml  Tuber melanosporum
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tml00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    GSTUM_00009565001
  Replication and repair
   03420 Nucleotide excision repair
    GSTUM_00009565001
Transcription machinery [BR:tml03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     GSTUM_00009565001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 422 aa AA seqDB search
MDDTIYSTSTQHRLFTFTPKQLSDLRYATNKAAIEKITESIKRRAVAAGIVESEIEEIDC
PTAEEELKLVAYYCVKCMQLSDHFQFPSNVKATALTFLHRLYLTTSTLTLHPKKLLLPIL
YLATKTENHYTPIKNFIATAATAGPKVTKEDLLDPEFTIAMGLRWAFQVWHPFRGLEGIF
LELNAIASGRYQPPKPKEHLVLPATEAKVALLELLAGDTDRIGRAHGEARRLLTTTALLT
DVYFLYTPPQISFGAFLEADRELATFYLDIKFPETDVPGRKTKMKLLDVLDEIAKNHLSA
GLSEDLKNPYQGLLLQLPQNGITTSLSMSVDPTLVKEVTRIDKKLYRVTKRDQDSAGKKK
AEEWNGSGSQSGTGSGNGIGRYDEDEERRAKKRRLEREKAEREGDVFGARLPDVKTAGAG
SF
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaccatatactcgacaagtacacaacataggctgttcaccttcacgccaaag
cagctctcggacctacgctatgccaccaacaaagccgcgatcgagaagatcacagagtcg
ataaagcgacgggcggtcgcagcggggattgtcgagtcggagatcgaagagatcgattgt
ccgacggcggaagaggagttaaagctagttgcatattattgcgtgaaatgtatgcagttg
tcggatcattttcagtttcccagcaacgtcaaggcgaccgcgctaacattcctccatcgc
ctctacctaacaacatccaccctcaccttgcacccaaagaagcttctcctaccaatctta
tacctagcaacgaagaccgagaatcactacacgcccataaaaaacttcatcgcgacggcc
gccacggccggccccaaagtgacgaaggaagacctcctggaccccgaattcacaatagca
atgggcctacgctgggccttccaagtctggcaccccttccgcggcctggagggcatattc
ctggaactcaacgcgatagcatcgggccgctaccaaccgcccaaacccaaggaacacctc
gtcctgcccgccacggaggccaaagttgcactgctggagctcctggcgggggacacggac
cggatcgggcgagcgcacggggaggcgagaaggctgctgacaacaactgccctcctgacg
gacgtgtacttcctctacacccccccgcagatcagcttcggcgccttcctagaagcagac
agggagctcgctaccttctaccttgacattaaatttcccgaaaccgatgtgcccgggaga
aagaccaagatgaagctcttggacgtgctggacgagatcgccaagaaccacctctctgct
ggcctatctgaggacttgaaaaatccttatcagggcttactcctccagttgcctcagaat
ggaatcaccacttcactctctatgtccgtggaccctacgctcgtcaaggaagttacgagg
atcgacaagaagctctaccgtgtcactaagagagaccaggacagcgctggaaagaagaag
gcggaggagtggaatgggagtggtagccagagtggtactgggagtggcaatggtattggg
aggtacgatgaggacgaggaacgccgtgccaagaagcgcaggctagagagggagaaggcg
gagcgtgaaggggatgtcttcggcgcccgcctgccggatgtcaagactgcgggtgcgggg
tctttttag

DBGET integrated database retrieval system