KEGG   Tuber melanosporum: GSTUM_00009673001Help
Entry
GSTUM_00009673001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tml  Tuber melanosporum
Pathway
mRNA surveillance pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:tml00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    GSTUM_00009673001
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    GSTUM_00009673001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     GSTUM_00009673001
Protein phosphatases and associated proteins [BR:tml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     GSTUM_00009673001
Transcription machinery [BR:tml03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     GSTUM_00009673001
Spliceosome [BR:tml03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    GSTUM_00009673001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 325 aa AA seqDB search
MADQTEVDLDSIIDRLLEVRGSRPGKQVQLLEAEIRYLCTKAREIFISQPILLELEAPIK
ICGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFI
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDL
NSMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHD
MDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAE
KKQKYVYGGMGTGRPVTPPRKQKKK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccaaacagaagtcgatttggactctattatcgataggctactggaagttcgt
ggcagccgtcctggaaaacaggttcaattgttggaagccgaaattcgttatttatgtact
aaggccagagaaatatttatatcgcagccaatcctgctggagttggaggctccaatcaag
atttgcggagatattcacggacaatactatgaccttcttagacttttcgaatacggtgga
ttccctccagaggcgaattatctgttccttggcgattacgtcgatcgagggaaacaatcc
ctcgaaactatctgcctcctcctggcgtacaaaattaagtacccggaaaatttcttcatc
cttcgtggcaaccacgaatgtgcctccataaaccgtatatacggcttctatgatgaatgt
aaaaggagatataacatcaagctatggaagacatttacggattgtttcaactgtctgccg
attgctgctatcatcgacgagaagattttcactatgcatggtggcctttcccctgatctc
aactctatggagcaaattcgtagggtcatgaggcctactgacatccctgattgcggttta
ctctgcgatcttctttggtccgacccagataaggatatcactggctggagtgaaaatgat
cgtggtgtctctttcacatttggccctgatgttgtctcgagatttttgcagaagcatgac
atggacctcatctgtcgtgctcaccaggtcgttgaagacggttacgaattcttctccaaa
agacagcttgtcaccttattctccgcacccaattactgtggtgaatttgataatgctggt
gcgatgatgagtgttgatgagagcctgctgtgctcgtttcagatcctgaagcctgctgag
aagaagcagaagtatgtttacggtggaatggggacgggcagacctgttactcctcctaga
aagcagaagaagaagtga

DBGET integrated database retrieval system