KEGG   Tuber melanosporum: GSTUM_00009918001Help
Entry
GSTUM_00009918001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tml  Tuber melanosporum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 377 aa AA seqDB search
MASMARVLTRASKQASFTSTPLCRNFTTATRARPTTSIAAPIRQTGRRGYASGGSAGGGS
SKIAIPLGLGLIGAGGYYAYTNDLLPAALSGAQASKTGGVLTPTKDDFQKVYNDVAELLE
NNDYDDGSYGPVVVRLGWHASGTYDKDTKTGGSNGATMRFAPESEHGANAGLKTARDLLE
GIKKKHPWISYSDLWTLAAVAAIQEMGGPKIPWRPGRKDGDVSACTPDGRLPDATKEQKH
LRAIFYRMGFNDQEIVALSGAHALGRCHTDRSGFDGPWTFSPTMLTNDYYKLLLEEKWAW
KKWNGPKQFEDVSTKSLMMLPTDMALVKDKEFRKHVERYAKDNDLFFREFADAFGRLLEL
GVPFEKEEKFVFKSTTD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcatccatggcccgtgttctcactcgcgcttcgaagcaagcgtccttcacctccact
cccctctgccgcaatttcacaactgcgacccgcgctcgcccgaccacctctattgccgca
cctattagacagactggccgccgtggatatgcttctggcggttcagcgggtgggggttct
agcaagatcgctatcccattgggtcttggtttgattggtgctggtggttactatgcttac
accaatgatcttctccccgccgcattgtctggcgcccaggcctcgaagactggcggcgtg
ctcacccccactaaggatgactttcagaaggtctataatgatgttgcggagctcttggag
aataatgattacgacgatggttcctatggacctgtagttgtccgccttggatggcacgca
tctggaacttatgacaaggataccaagactggaggttccaatggggccaccatgcgtttc
gctcctgagtcagagcatggtgcaaatgccggcttgaagaccgcacgtgaccttctcgaa
ggtatcaagaagaagcacccttggatctcgtactccgacctctggactcttgctgctgtt
gctgcaatccaggagatgggtggtcccaagattccgtggagacccggacgtaaggacggt
gacgtatccgcttgcactcctgatggtcgtcttcccgacgccactaaggaacagaagcat
ctcagagccatcttctaccgtatgggtttcaacgatcaggagattgtcgctttatcgggt
gcccacgctctcggcagatgccacaccgatcgttccggctttgatggtccctggactttc
tcgccaacaatgctgacaaacgattactacaaactcttgctcgaggagaagtgggcctgg
aagaagtggaatggaccaaagcaatttgaggatgtttcgactaaatctcttatgatgctt
ccaaccgacatggcgctcgtcaaagacaaggagtttaggaagcatgttgagaggtacgcc
aaggacaacgacctcttcttcagggagtttgcggatgcctttggaagactgctcgagctc
ggtgttccttttgagaaggaggagaagtttgttttcaagtccactacagattaa

DBGET integrated database retrieval system