KEGG   Tuber melanosporum: GSTUM_00010215001Help
Entry
GSTUM_00010215001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tml  Tuber melanosporum
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GSTUM_00010215001
   00670 One carbon pool by folate
    GSTUM_00010215001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     GSTUM_00010215001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 202 aa AA seqDB search
MALQNLNLTVIVATTHSLGIGKSGTLPWHLPTDLSYFSRVTKRPPPSQSPSTSPPVLNTL
IMGRKTYFSIPPKFRPLPSRRNIVISRSSRPDSFNDASTWVTSFPDAIAAAGGDGGRIFV
IGGAEIYKLAMEDERTRNVLLTRVEGEFGCDRFFPVDVRDEGNTGWAQRGHEELCAFVGE
AVPAGAREENGVRFWFELYQRP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcgctccaaaacctaaatctaacggtaatcgtcgcaacaacccactccctagggatc
ggaaaatccggcacactaccatggcatctcccaactgacctctcctacttctcccgcgtc
acaaagcgtccccccccatcccaatccccatccacatcccctccggtgttaaacacccta
ataatgggccgaaaaacatacttctccatccctccaaaattccgcccgctgccatcacgc
cgcaacatcgtcatctcccgttcctcgcggccggattctttcaatgacgcgagtacctgg
gtcacctccttccccgacgcgattgctgctgcgggcggcgacggcggcaggatattcgta
attggcggtgcggagatatacaagcttgccatggaggacgagaggaccaggaatgtgcta
ttgactcgtgttgagggggagtttggctgtgaccgattctttccggtggatgtcagggac
gagggaaatactgggtgggcgcagagggggcacgaggagctttgcgcattcgttggggag
gcggtgcccgcgggggctagggaggagaatggggtgaggttttggtttgagctgtatcag
aggccttga

DBGET integrated database retrieval system