KEGG   Tuber melanosporum: GSTUM_00010377001Help
Entry
GSTUM_00010377001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K08287  
dual-specificity kinase [EC:2.7.12.1]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     GSTUM_00010377001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 662 aa AA seqDB search
MSTPSTASAVLPPLSHYRYDYTRDHHRVLHPPPHAHLLNRTHLASPIYHSPVPVTTASTP
TNSSFSSSTISAMASSRTQPSVKRNRNRTPNWEDFYKNGLPKEVIVIDDSPPPESGHLGA
NTNSKHSQPSSSSRVVAANGHQYPSTNNIAGGAYGPRHADKKRKVQTSQYEPSYTSQHQH
SYSSTQTPHANFGSPTTISATSSTVSVNGNSTAGTSLGSNVGAGPSYSGASLASINGQKR
KRVTRASQAAAAAANNGLDPYSSYHPPPRPPIKAKDVYVQPIPDPGRHPTGRVDDDDGHY
IINLETDLTPRYRITKQLGQGTFGKVVEAYDRVKKTKCAIKVIRSVQKYRDASRIELRVL
ATLSCNDKENRNKCIHLRDCFDYRNHICIVTDLLGMSVFDFLKGNSFAPFPNSQIQSFAR
QLLTSVAFLHDLNLIHTDLKPENILLGRTRRVLLDTDIRLIDFGSATFDDEYHSSVVSTR
HYRAPEIILGLGWSFPCDLWSIGCILVEFYTGDALFQTHDNLEHLAMMQAVVGQKIDTRL
IRAVAGTGRTAVSNAVSRYFKGTRLDYPNDETTRASKKYVHAMKPLPDIIQPTTNFNKQF
FDLLKRIFVYDPNKRITAKEALKHPWFREVVQDEGTEATKLRLERQAERLAAAATLSRGE
GY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtctactccctccaccgcttcagccgtcctacctcccctcagtcactaccgttacgac
tacactcgagatcaccatcgcgttctccatcctcctcctcacgctcatctcttgaatcgt
acacatctcgccagtcctatttaccactctcccgtgcctgtgacaaccgcttcgacccct
accaactcttctttttcttcgtcgacgatctcggctatggcttcctctaggacccagcct
tcggtgaagaggaatcgtaatcggactcctaactgggaagatttctataagaacgggctc
cccaaggaggttattgtcattgacgattctcccccgccagagtcgggccacttaggtgcc
aacaccaacagcaaacactcgcaaccatccagctcatcccgtgtagtagcagccaatgga
catcagtatccttccacaaataacattgctggaggtgcgtatggccctcgccacgccgac
aagaaacgaaaggttcagacatcgcaatacgaaccttcatataccagccagcatcagcac
tcttactcttctacccaaacccctcacgctaattttgggtctcctaccaccatttctgct
acttccagcacagttagtgtcaatggtaattcaactgctggtacatcactcggatcaaac
gtaggggcagggccttcttattctggagcatcattagcttcgatcaatggccagaaacga
aagagagtaacaagggccagccaggcggcggcggcggctgcgaacaatgggttagatcct
tattctagctatcaccctcccccaaggcctcctatcaaagcgaaggatgtgtatgtccag
ccaattccagatcccggtagacatccgactgggagggtggatgatgacgatggtcactac
attatcaatctcgaaaccgatttgacaccgcgataccgaattaccaaacaacttggccaa
ggaacttttggcaaagttgtagaggcatatgatcgtgttaagaaaactaaatgcgctatt
aaggtcatcagatcagttcagaagtatcgggatgcgtcccgaatcgagttgagagtgctt
gcgaccttatcttgcaatgacaaggaaaataggaataagtgtatccatttgagagattgc
tttgactaccgcaatcacatatgtatcgtcaccgatttgctcgggatgagcgtattcgac
tttttgaagggaaattcattcgcaccatttccaaacagtcaaatccagagctttgctcgc
cagctattgactagtgttgcatttcttcacgatctgaacctcattcataccgatcttaaa
ccggaaaatattctcctcggccggacccgccgtgttctcttggacacggatattcgtcta
attgatttcggatccgctacgtttgatgatgaatatcattcgagcgtggtttctacccgc
cactaccgtgcgcccgaaattattctgggcttgggttggagtttcccatgtgatctctgg
agcatcgggtgtattttggtggaattttacactggcgacgctctttttcaaacccatgac
aatcttgagcacttggcaatgatgcaggctgttgttggacaaaagatcgatacgaggctt
atcagagcagtagcggggactggaagaactgcggtgtccaacgcggtttcgagatatttc
aaaggaacccggctcgactatcccaacgatgagacaacaagagccagtaaaaaatatgtt
cacgctatgaagcctctcccggatatcatccaaccgaccacgaacttcaacaagcagttt
ttcgatcttctcaaaaggatattcgtttacgatcctaacaagcgcatcactgccaaggag
gcgctgaagcacccatggttccgcgaggttgtgcaggatgagggaactgaagctacaaag
ttgagactggagagacaggcggagcggctggcagcagcggcgacattatcacgtggagag
gggtactga

DBGET integrated database retrieval system