KEGG   Tuber melanosporum: GSTUM_00010689001Help
Entry
GSTUM_00010689001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
tml  Tuber melanosporum
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tml00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    GSTUM_00010689001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 361 aa AA seqDB search
MSYFTNSSGSASTGSATTSSSLGDISADITLSSPPEDSISDLEFSTKSDLLAVASWDKRV
RIYDVSQTGANSGKAIYAHEGPVLSVAWSIDGDKLVSGGTDNAARLWDVATGQSTQVAAH
DDPIRSVRWFTPPGANAQMVVTGSWDKTIKYWDLRQQQPVCLVKLPERVYTMDVSRDLLV
VGTAEKHLQIINLKNPETVFESRISPLKWQTRVVACFPDASGFAVGGIEGRCAFVYLDPK
NTKLDFSFKCHRTARTRGAGADVYGVNAISFHPVHGTFSTAGADGTFHYWDKDSRSRTKG
FPPVGGIISATGFNRNGSIFAYAVSYDWSKGHQHNTPTYPNKIMLHRVGDEEAKRKVTSK
Y
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcttactttacaaatagttccgggtctgcttccaccggatccgctaccacctccagt
agtctgggagatattagtgccgatataacgctgtcctcacccccggaagacagtatctct
gacctagagttctccacgaagtcagaccttttggcagtcgctagttgggacaagagagtt
cgcatttatgatgtttctcagaccggggcgaactccggtaaagcgatttacgcacatgaa
gggcccgttctcagtgtggcttggtcaatagatggtgataaactcgtctcaggaggtacc
gataacgctgcaagactgtgggatgttgctacaggtcaaagcactcaggtcgccgcccat
gatgatccaatccgctctgttcgttggtttactccgccaggagctaacgcccaaatggtg
gtcacaggatcatgggataaaacaatcaagtactgggacctaaggcagcagcaacctgtt
tgtttggtgaaattgcccgagcgggtttatacgatggatgtttctcgggacttactggtc
gtagggactgcagagaagcatctccaaatcatcaacctgaaaaatccggaaaccgttttc
gaatcaaggattagtccgctcaagtggcagacccgcgtagttgcctgtttcccagatgcg
tcgggcttcgcagtcggtggtatcgaggggaggtgcgcttttgtctatcttgaccccaaa
aataccaagttggatttctcgtttaaatgccatagaacagctagaactagaggcgccggc
gctgatgtttatggagtgaatgctatctcctttcatcctgtgcatggaactttctccact
gctggcgctgatggaaccttccactattgggacaaagattccagaagcagaaccaaaggg
tttcctcctgtcggtggaataatctccgccaccggcttcaatagaaatggctcgatcttc
gcctacgcggttagctacgactggagcaaaggccaccaacacaacactccaacatacccg
aataagataatgctgcatagggtgggcgatgaggaagcaaagcgaaaggttacctcgaaa
tactaa

DBGET integrated database retrieval system