KEGG   Tuber melanosporum: GSTUM_00010820001Help
Entry
GSTUM_00010820001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tml  Tuber melanosporum
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tml04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 664 aa AA seqDB search
MRFSTFIPLLFAALAAPLVVGEPIQTARTASVATVAPASAATLPAKVESEVKAPDIIELT
TGNFWTTIGKSYWFVKGYSPTCPHCIKAAPIWKQLHDKYATQVVDSGTPPSPNSNPGSPS
SSPTFTEKYDFHFANINCVSYGDICADKKVGIEMFPSFILFKDGKAIEQYPIEADRTVED
MSKFVDKYIVEIAAKSNRNLALPKTIYDESKNPEGKSVALAADDFLKEVIGTGDGWFIKF
YAPWCQHCQALASTWAELGREMKNQLNIGEINCENDRRLCKELKIRGYPTIIYFQHGERI
EYNGLRGLGDLVSFAKKAVDSSIKEIEFTDFEEMEKGGMEVAFLFFYDSATTTEDFKAME
RLPLTLIGHAPLLKTKSELLARRFRITTWPRLIVVRDGHPSYFPGISPGAIRDFGRVTGW
ARTVWLPILPELSASNSHEVMNGKTVVLGILSRDRPKDFAAAKKELKAAALEFMDQRQLQ
EKNEKQELRDKKQLRIEEAEDRNDQRALRAAKNMKINLEKKKEVGFAWVDGVFWERWVRT
TYGINVGEMGERIIVNEEDTKQYWDTTLEGTAIVPSRSTILDTLKAVIAEHPRIRSKSTT
NRFETAYYQIRAKVSNHPLVSWFLLASVVIALAVWGRGRMKRRGTGGFFRLESTKEEGVG
GKVD
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttttcaacatttattccattactattcgctgctcttgcggccccgctagtggtc
ggagagcctatccagaccgctcggactgctagtgttgctactgtagcacctgcttcggct
gctactttgccggcgaaggttgaatcggaagtcaaagctcctgatatcatcgagttgaca
acggggaacttctggacaactatcgggaagagttactggtttgtgaagggatactcgccg
acgtgtccacactgtattaaggccgcccctatatggaagcaattgcacgacaagtacgcg
acccaggtggtagattcagggactcccccttcgcctaattcgaaccctggatccccgtct
tctagtccaaccttcacggagaaatatgactttcactttgccaatattaattgcgtttcc
tacggtgatatctgtgccgataagaaggttggaattgagatgttccctagctttatcctc
ttcaaggatggaaaggctatcgagcagtacccgatagaagcggaccgcactgtggaggat
atgtctaaattcgtcgataagtacattgtggaaatcgctgccaagtcaaatcgcaatctt
gctcttccgaaaaccatttacgatgaatcgaagaaccctgagggtaagagtgtcgcattg
gctgcggatgatttcttgaaagaggttatcgggaccggtgatggatggtttatcaagttt
tatgctccttggtgccagcattgccaggcattggcttcaacatgggccgagcttggccgt
gagatgaagaaccagcttaacattggagagatcaattgcgagaacgatagacgtctttgc
aaagagctcaagattcgcggatatccgaccattatttatttccagcacggtgaaaggatt
gagtataatggtcttcgtggtctcggagatcttgtctcgtttgccaagaaagctgtcgat
tcaagcattaaggaaattgagttcaccgactttgaggagatggagaagggtggtatggag
gttgctttcttgttcttctacgattctgccaccaccaccgaagacttcaaggctatggag
aggcttcccttgacccttattggccatgctcctctcttgaagactaagagtgagcttctc
gctagacgtttcagaataaccacgtggcccaggcttatagttgttcgtgacggccatccg
agctatttcccgggtatctccccgggtgccattcgtgattttggccgtgtcaccggatgg
gcgcgcactgtttggcttcccatcctccccgagctctctgcatccaactcgcatgaagtt
atgaatgggaagactgttgttctcggtatattatctagggataggcccaaggactttgcc
gctgcgaagaaggagcttaaggcggctgccctagagtttatggatcagcgccagcttcag
gagaagaacgagaagcaggagttgagagacaaaaagcaacttcgaatcgaagaggctgaa
gacagaaatgaccaaagggctctcagagccgcgaagaacatgaagattaacttggagaag
aagaaggaagttggctttgcctgggttgatggcgtcttctgggagcgctgggtcaggact
acgtatggcattaacgttggggagatgggcgagagaattattgttaacgaagaagatacc
aaacaatattgggataccacgctcgagggcactgccattgtcccctcgcgctcgactatc
ctcgataccctcaaggctgtcattgccgagcatcctcgcatcagaagcaagagtactacg
aacaggttcgagactgcatactaccagatcagggctaaggtttccaaccatcctttggtc
tcgtggttcctccttgcctctgtcgttatcgcgctagccgtttggggtcgtggacggatg
aagaggcggggcactggtgggttctttaggcttgagtctaccaaggaggaaggtgttggt
ggaaaggttgattaa

DBGET integrated database retrieval system