KEGG   Tuber melanosporum: GSTUM_00010907001Help
Entry
GSTUM_00010907001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tml  Tuber melanosporum
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    GSTUM_00010907001
Enzymes [BR:tml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     GSTUM_00010907001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 378 aa AA seqDB search
MKSLLSLLLPFLPLALSRAGKEYIEEDILNLRQKWAVEHPFGGISTFAHLQHVRCLVDPH
EEFDIAILGAPFDTAVSYRPGARFGPRAIRAASARQSESRGFNVRAGINPYLSDVKILDC
GDIPISPFDNELALRQMTEAYKELMSRSTPSGRRPIIVTLGGDHSIALAALRGVNSVYGP
VSVVHFDAHLDTWYPTKYPSSWPTLQSAFTHGTMFHLAYNESLLLPTYNIHAGLRTRLSG
ADMSDYAGDDAQGWARISTDDIDDIGVAGIVKRIVDHVGKSKVYLSIDIDVLDPGIAPGT
GTPEAGGWTTRELIRILRGIEGLDVVGVDVVEVAPAYDCAENTALAASQVVFEVLSSLAK
KARATVKLEGEGEARDEL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccctcctttccctccttctgccatttctgcccctcgccctctctcgtgcgggg
aaggagtatatcgaggaggacatcttaaacctccgccaaaaatgggctgttgaacaccct
ttcggcgggatctccacctttgctcatcttcaacacgtccgctgcctcgttgacccgcat
gaagagttcgacatagcaattcttggcgcaccattcgatacagctgtatcctatcgaccg
ggagcacgcttcggcccacgcgcgatacgtgcagcgagcgctagacagtctgagagtagg
ggatttaatgttcgtgcgggcataaatccgtacttgtcggatgtgaagatacttgattgc
ggggacattccgatatcgccattcgataatgagctcgcactgcggcagatgaccgaagcg
tataaggaattaatgtcccggtctaccccttctggccgccggccaataattgtcacgctg
ggtggggaccactcaattgcactggcggcattgcgtggagtgaatagcgtctatggacct
gtttctgtggttcactttgacgctcatctcgacacctggtacccaacaaaatacccctcg
tcctggccaaccttacaatccgctttcacccatggcaccatgttccacctcgcttacaac
gagtctctcctgctccccacatacaacatccatgcgggcctacgcacccgcctttccggc
gcggatatgagcgactacgctggtgacgatgcccaaggatgggcaagaatctcgaccgac
gacatagacgacataggcgttgccggaatagtcaagaggatcgtggatcatgttggcaaa
agcaaagtgtacctttccatcgatattgacgttctggaccctggaatagcgccgggtact
ggaacgcccgaagctggagggtggactacgagagagttgattaggatacttcgggggatt
gaagggctggacgtggtgggggtggatgtggttgaggttgcccccgcctacgattgtgcg
gaaaatactgcgttggcggcatcgcaggtggttttcgaggttctgagcagcttagctaag
aaagccagggctaccgttaaactggagggagagggagaggcgagggacgagttgtaa

DBGET integrated database retrieval system