KEGG   Tuber melanosporum: GSTUM_00011144001Help
Entry
GSTUM_00011144001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
tml  Tuber melanosporum
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 792 aa AA seqDB search
MPRSAVPASSVDSEVSLSLLVSLIIAGVFVVYNFLYELVGLPPLWELIFVMIPGLLLGPR
ARETLESAFGISTDCGLGIVARVRNRAASLVGGQLVPAGYSPDGEGLIGGLWNSGNTCYQ
NSVLQAMASLSHLKPHLALLSLSELEDGLTPSGALISLITDLNTLTSGPRASTPSPIIVR
GTDNSGWVYNEQQDAQEFFQKLTGSLEKEVSRFLSRRKESAARGLESVRELEGVGGEEKA
PVSGADSDVTVAKDLRSPFEGLFAQRMFPPFSYLSLTKLPHKWSCSLEECLSEFTAIEKI
PEVDCDKCTLLSLCNRLKNFLEPPAGSETSSPTLQEPTRLEMQQRLTALARAIEEDNFSP
NVPGVKISPKQKISSTKTKQTMIARPPPILVLHLNRSQYDIMTGLTGKNHAVVSFPARLD
LGKSGAVTRHDTAGGSWGLTVDPALPMSGRVPRWVEKPIVSQQDSGNANKMQQKDFIREN
GPEGVLYELKSVVVHHGGHHNGHYTCYRKLHNTWFKTSDHEVYVVEESAVLNIGKVFMLF
YERVNNFHGNGSAKFGPNSSVSGGPGTTLVANSCGGEPDYGIDEDEQHPKPNGATITPGK
DFPPGSTSSSSTRSPEITPPASPKNPPELPIESSEDAHTLVEAYLAALKTYTSLRGTITS
TLSAGQVALSQVETDESIFETPTTPENGVEIDLGTGFRIHTFSPPAITEPATNGVRKRKG
EDKEASANESSTSTLSAPLKKAQGGLISVTATETISSALQTLQTLETRIASDSEASSLLK
GRYKQRTQGIVA
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgccccgctctgctgttcctgcttcctccgtcgattccgaggtctcgctgtcactgctt
gtctctctgattatcgcgggtgttttcgtcgtctacaactttctttatgaactagttggg
cttccaccgctctgggagctgatcttcgtaatgattccggggctattactaggtcctagg
gctcgtgagacgctggaaagcgcctttgggatctcaacggattgtggtttgggaattgtg
gctcgagttcggaatcgtgctgctagtctcgtgggcggacagttggtccctgcgggatac
tcaccggatggggaaggtttgatcgggggattgtggaattccgggaatacctgttaccag
aactcggttttgcaggctatggcttcgctctcgcatctcaaaccgcatctcgcgttgctc
tcgctctcggaactggaggatgggctgacgccatccggggctcttatctcgctaatcacc
gacctcaatacgcttacctctggtccccgcgcgtctacaccttcgccgattatcgtacgg
gggacggataattccggatgggtttacaacgaacaacaagatgcgcaggagttttttcag
aagcttacgggatctttagagaaggaggtttcgaggtttctgagccggcgcaaggaaagt
gcagcgagggggttggaaagtgtacgggagttggagggagtcggcggcgaggagaaggcg
ccggtttcgggcgctgactctgatgtaaccgttgcgaaggacttgcgaagcccttttgag
ggattgtttgctcagagaatgttcccgccgttttcgtacttgagcctcactaagttgccg
cacaagtggtcctgttctctggaagagtgtctatcagaattcacagcaatagagaaaatc
cccgaagtagattgcgacaaatgcacacttttgtccctctgcaacagactcaaaaacttc
ctcgagccacctgccggatccgaaacctcatctccgaccctccaagaaccaaccaggctc
gaaatgcaacagcgtctcactgctctcgcgcgagcgatagaggaagacaacttttcccca
aatgtgcccggagtaaagatctctccaaagcagaagatctcgtcgacaaagacgaaacaa
accatgattgctcgtcccccgccaatactagtcctgcatttgaataggagccagtatgac
ataatgaccggcctgaccggcaagaaccacgctgtggtatcattccccgcacgccttgac
cttggcaaatccggagcggtcacacgacatgatactgcaggcggaagctggggcctaacc
gtggatccagcactacccatgtccgggcgtgtacccagatgggtggagaaacccatagta
agccagcaggactctgggaacgccaataagatgcaacaaaaagacttcatccgagagaac
ggccctgagggagtcctctacgaactaaagagcgtagtggtacatcacggcggtcaccac
aacgggcactacacttgctaccggaaactccacaacacctggttcaaaactagtgatcac
gaggtctatgtcgtcgaagaaagtgccgtcctcaacattgggaaagtattcatgttattt
tacgagcgcgtgaataatttccatgggaacgggagtgcaaagttcggacctaactcttcg
gtgagcggtggacctggtacaacgcttgttgccaacagctgtggtggtgagccagactac
ggcatcgacgaggacgagcagcacccaaagcccaacggcgctactataacccccgggaag
gacttcccccccgggagtacttcttcctcatctacgcgcagtcccgaaatcacacccccc
gcaagtccaaaaaaccccccggagctacccatagagtctagcgaagatgcgcacacactt
gtggaagcgtatcttgctgcactgaaaacatatacttcacttcgtggcaccataacatcg
accctttccgccggtcaggtagcactatcacaggtggaaacggatgagtcaatcttcgaa
acccctacgacgccagaaaatggtgtggagattgacctgggtacgggcttccggatccac
actttctcaccaccggcaataacggagccagcgacaaatggcgtccgcaaacgaaaaggc
gaagacaaggaagcctccgccaatgagtcttccacctctactctgtccgcgccattaaaa
aaggcgcagggggggctcatttctgtaacagcaacagaaaccatatcctccgctttgcaa
accctacagaccctcgagacacgtatagcttcagattcagaagcctcatcgctgctgaaa
ggaaggtataaacaacggactcagggaattgtagcctaa

DBGET integrated database retrieval system