KEGG   Tuber melanosporum: GSTUM_00011734001Help
Entry
GSTUM_00011734001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
tml  Tuber melanosporum
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:tml03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 340 aa AA seqDB search
MESNSLWNRRSNTGKLSLSVSSSAHNNSNNNTTGDAPSSRIFGPPSAKLTSSHKPSYENP
FAKLHNINTGHPALPSPTANAAKSASAAFNLGIGGAFGSFGLKTPKTPGGDGLNAAGSIS
TGAIATPSLPKGLTASEVVAGTKKSNSNLAAVNQQDSHPLKNVWVVWYRSPGNKFQDYEK
STQKIAYFGTVEEFWCVYCHLRRPNVLPHVSDYHLFKKGIRPVWEDKENRKGGKWNIRLK
KGVSTRYWEELLLAIVGDQFGDAGEDLCGAVLSIRGNEDVLSVWTRVDGSSCLKIKETVK
RRLNLPQGTRIEWKSHASSLEAVNQKSQSQNQNQGQAQPQ
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggagtctaattcactatggaaccgacggtccaacactggtaaactttctctttcggtg
tcttcgtctgcgcacaataacagtaacaataataccactggcgatgccccctcctccagg
attttcgggcctccctctgccaaactcacctcttctcacaaaccgtcgtatgaaaatccc
ttcgccaagctacataatatcaatactggtcatccggcacttccgtctccaaccgcaaac
gcagccaagtctgcgtctgctgccttcaatctcgggatcggaggtgcctttggctctttt
ggactcaagactccgaagactccaggcggagacggtctgaatgctgctggtagtatcagt
accggcgcaattgctaccccttcgttgccgaagggtttgactgcctccgaagttgttgct
ggaaccaaaaagtccaacagtaatcttgctgctgttaaccagcaggattcccatccattg
aagaatgtttgggtagtttggtaccgctctccgggaaacaagttccaggactatgaaaag
tccacgcagaagattgcgtattttgggaccgttgaggagttctggtgcgtctactgtcac
ttgcgcaggccgaatgtcctgccacacgtgagcgactaccatctctttaagaaaggaatt
aggccggtttgggaggacaaggagaataggaagggtgggaagtggaacatccgtctgaag
aagggtgttagcactagatactgggaggaacttctcttggcgattgtcggcgatcaattt
ggtgacgccggtgaggatctttgtggggctgttttgagcattagaggaaatgaggatgtt
ctcagtgtttggactagagtggacgggtcgagctgcttgaagatcaaggaaactgtcaaa
cgcaggcttaaccttccacaaggaaccagaatcgagtggaaatcccatgcatcctccctt
gaggcggtcaaccagaagtcgcagagccagaatcaaaatcagggccaggctcaaccccag
taa

DBGET integrated database retrieval system