KEGG   Tuber melanosporum: GSTUM_00011865001Help
Entry
GSTUM_00011865001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
tml  Tuber melanosporum
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:tml04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 573 aa AA seqDB search
MTEEPGFKGKSLKRKNVKGLKLGGGGGGGAPAAAPSVPDTQAPGGNGSRYYAHNDQLSDQ
LSTLEIGVEFKLDLRAEDLKVVNELGAGNGGTVSKVIHAPTKALMAKKVIHIDAKPSVRK
QIVRELHIMQECHSPYIVSFYGAFLNEGDVVMCMEYMDCGSLDGIAKKIGPIRIDVLGKI
SEAVVEGLNYLYNVHRILHRDVKPSNILVNSRGSIKLCDFGVSGELINSIADTFVGTSTY
MSPERIKGAKYSVKSDVWSLGLTLLELAIGRFPFDADGTSAGTRASAGPMGILDLLQKIV
NEPAPKLPKNKAFPPSLEKMIEHCLIKDPEQRPSPQELLEESFMRAAKQTNVDLEAWAHI
ILDKPLNRSSRSSQLISPAPVHRESPAPPRPSSRGQHTPGRRTSTTERSSSERGTERERS
DREHRVPPASLQQAPFPTRTSSHGPGSGRLEEVNYYCSGDSSRGSQLPHSRSSRQAQYRS
NTEPTGRSASDRNDSRERCARGQGSEKERERGREQEYVQGTIGIGFEGARQPEMREKKKQ
PPVGIMSSGGGLSFVGSGNAIGSSGPNGISSGQ
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggaacctggctttaaaggcaaatcgctcaagagaaagaatgttaaggggcta
aagctcggtggaggaggaggtggtggagctcctgccgcagccccttctgtcccagacacc
caggctcctggcggaaacgggagtagatactatgcccacaatgaccaactaagtgatcaa
ctcagcactcttgaaatcggtgtcgagtttaagctggatttacgtgcggaggatttgaag
gtggtgaatgaattaggtgcggggaacggagggactgttagcaaagtcatccatgctcca
acaaaagctttaatggcaaaaaaggtcatccacatagacgctaagccgtcggttcggaag
cagatcgttcgcgaactacacatcatgcaggaatgtcactccccttatattgtgtctttt
tacggtgccttcctcaatgaaggggatgtggttatgtgcatggaatacatggattgcgga
tctcttgatggtatcgctaaaaagattggcccgattcgcatcgatgttcttggaaagatc
tcggaggccgttgtggaaggattaaattacctctataatgtccatcgaatcttgcaccga
gatgtcaaaccctcaaatatcttggtcaactctcgaggctccatcaagctgtgtgacttt
ggtgtttctggagaattaatcaactcgatcgccgatacgtttgtcggtacttcaacttac
atgtccccagagcgaatcaaaggagccaagtactctgtcaaatcagatgtatggagcttg
ggactgaccctgttggagttggccattgggaggtttccttttgacgcagacggtacaagt
gctgggacccgggccagtgctgggccaatgggtattcttgatttgcttcagaagatcgtc
aacgagcctgcgcccaaattgccaaaaaacaaggcattccctcctagtttggagaagatg
attgagcactgtttgatcaaggatccggagcagaggcctagccctcaagaacttctggaa
gaatcatttatgagggcggccaagcagaccaatgtggacctcgaagcttgggctcatatt
attctcgacaaacctctcaatcgatcctcaagatcctcgcaattgatcagccccgccccc
gtccaccgagagtctccggctccaccgcgtccatcatcacgtggtcaacacactcccggg
agaagaacctctactactgagcgcagctcaagtgaacgaggtactgaaagagaacggtct
gatcgcgagcatcgcgtacctccggcctcgctgcaacaggcaccttttccaacccgtaca
agctcgcacggtcccggttctggaagacttgaggaggtgaactattactgctcaggtgat
tcgtccagaggcagccagttaccgcattcaaggtcctcccgccaagctcaataccgatcg
aacactgaacctacggggcgctcggcgtcagatcgaaatgatagcagagagagatgtgct
cgtggtcaaggtagtgaaaaggaacgcgagaggggacgcgaacaggagtacgtgcagggc
acaattgggatcggatttgagggcgcacgccagccagaaatgagggagaagaagaagcag
ccgcctgttggcattatgagctcaggaggaggtctctcatttgtcggatctggtaacgcc
attggttcaagcggtcctaatggaataagcagtggccagtag

DBGET integrated database retrieval system