KEGG   Tuber melanosporum: GSTUM_00012042001Help
Entry
GSTUM_00012042001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GSTUM_00012042001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 935 aa AA seqDB search
MEGLRGGEGEDDSDIESVASTRSRRSTCSIGRRKRGDLDPRGAEEDEETEDQSSADDRSP
SESSSAVSSSSDDDDDEYGEDDEEEEEWQADKNGEPWQGVEDEDAEKPTKNLCIHCDKDE
DNDPSPEYEDPLECICGSFAHKQCDREANECGGVKSAFDEETSKWRCPSCAAGGHEPVSS
QKGLSSQSKHYRRPNTAKETPRLRERKRKRDDSNEDAINSRRRKRGKFDLPKKKYGNTSE
DEDGEFELEPEDEHRMEISHDEEQDAVSTSSDIQDTPPKGKQRLYEPRTPVVTYKKTARK
FHLHITNLTPGKLATVLATISNPNLIQPKPKSIPSGPKTEVHKPEKLPARRGRPLKSATA
RAPPKTHIPKPVFHNFSPQDNEKSKPYGGILTEEEASTELTLPGAEERDRFEKARAEAEA
EKETRLVISASLNPQPKQKNRDRNTRFADASKIECIHFGEYEIDTWYTAPYPQEYSENRV
LWICEFCLKYMNSEYVGWRHKMKCESKHPPGDEVYRDGSISVFEIDGRKHSLYCQNLCVL
AKLFLGSKTLYYDVEPFLFYVMTECNEFGMHFVGYFSKEKRISSQHNVSCILTLPIHQRK
GYGNLLIAFSYLLTRHENKTGSPEKPFSDLGLLSYRNYWKLTLCYELRSQSAPVTIVQLS
QRTGMTPDDVVCGLEALNALVRDPVTGTYALRIDYPALEAHIQKWEAKGYVKLNPDALVW
TPYVVGRSQAVQLNEPLPTIAPRPEPAALSNIGEDRGGNAIGDQGRNGSRSLTGDAMDMD
KIVPTLHTFDLKVPETPFTPFAPLRATPLAMKFASPSKWNSQMKSFMQDDNTDDIPPTRF
EIVPPPPGSYTKKMRAGSSVPRGRTPGTKNRRGRKTLDTPNGFSSGKARGEGTRDFHGSP
SSSAGPHQEGDQEGVPSGVDPGMRPGPSLVVASEV
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggagggtctgaggggtggagaaggagaggacgacagtgacattgaaagtgttgcgtca
accagatcccggaggtccacttgctctatcgggaggcggaagcgaggtgacttagatcct
aggggcgctgaagaagacgaggagaccgaagaccagtcctctgcagatgacagatcgcct
tctgaatcgtcctccgccgtctcctcttcctcagacgatgatgacgatgaatacggggag
gatgatgaagaggaagaggaatggcaagctgacaagaatggggagccttggcaaggtgtt
gaagacgaggatgccgaaaagcccacgaagaatctctgcatacattgcgacaaagacgaa
gataacgatcctagccccgaatatgaagatccgcttgaatgcatctgtggctcctttgct
cacaagcaatgcgatcgtgaagctaatgaatgtggtggagtaaagtcagccttcgacgaa
gaaacatcaaaatggcgatgtccatcatgtgctgcggggggtcatgagccagtatcgagt
cagaaaggcttatcttcccagtctaagcattataggcggccaaacacggctaaagaaacg
ccaagactaagggaacgaaagcggaagcgtgatgattcaaatgaagatgcaataaactct
cgtcgaagaaaacgaggaaaattcgatctcccaaagaagaagtacgggaacacgagcgag
gacgaggatggtgagtttgagctcgagccagaagatgaacatcggatggagatttcccat
gacgaagaacaagacgctgtctcgacaagttcggatatacaggatacacctcccaaagga
aaacaaagattatatgaaccacgaacaccagttgttacctataaaaaaacggcacgcaaa
ttccacttacatatcacaaacctcacaccaggcaaattagcgactgtccttgcaacaatt
tctaatccaaatctcatccagccgaaaccgaagtcaataccgtcgggcccgaaaacagag
gttcataagccagagaaattgcccgcccgcaggggccggccccttaaatctgcgactgct
agagccccgccaaagacccatatacccaaaccagtcttccataatttctcaccccaagat
aatgaaaagtctaaaccttatggtgggattcttactgaagaggaggcatctactgaatta
actctgcctggggccgaggaaagagaccgctttgaaaaggctcgtgctgaggcagaagca
gaaaaagaaacccgtttggtaatatctgcatcgctcaacccccaacccaagcaaaagaac
agggaccggaataccagatttgcggatgcttcgaagatcgaatgtatccatttcggggaa
tacgaaattgatacttggtatactgcaccttatccacaagagtacagcgaaaaccgcgtg
ttgtggatatgcgaattttgcttaaagtatatgaacagcgagtatgtcggatggagacat
aagatgaaatgtgagagcaaacatccgccaggcgatgaggtatacagagatggttcaata
tctgtttttgaaatcgatggcagaaagcactcactatactgtcaaaatctgtgtgtgctt
gcaaagctgttcttgggatccaaaacgttatattacgatgtggaaccatttctattttat
gtgatgactgaatgcaatgagtttggaatgcactttgtaggatatttctcaaaggaaaaa
cgcatatcaagtcagcacaatgtatcctgtattttgacattgccgatacaccagcgcaaa
ggatacgggaatctacttattgcattctcttatctacttacgagacacgaaaataaaaca
gggtcgcccgaaaagccattctctgatcttggattgttgtcctatcgaaactattggaaa
ctaactttatgttatgagctccgtagccaatcagcgccagtaactatcgttcagctttca
caacgcactgggatgacaccggacgacgtcgtttgtggtctagaggcattaaatgctctg
gtacgggatccagttactggaacctacgccttacgcattgactatcccgcccttgaagcc
catatccaaaagtgggaggccaaagggtatgtaaagctcaatccagacgcgcttgtttgg
acgccttatgttgttggacgatcccaagctgtgcaacttaacgagcctttgccgacaatc
gcaccaaggcctgagccggcggcactcagcaatattggagaagacagaggaggcaatgca
attggagaccagggacggaatggtagtagatctttaacaggggacgccatggacatggac
aaaatcgtcccgacccttcatacgtttgatttaaaggttcccgagacccccttcaccccc
tttgctcctctgagggcaaccccattggctatgaaatttgcatctcctagcaagtggaac
tcgcaaatgaagtcattcatgcaggacgataacaccgacgatataccgcccactagattt
gaaattgtccccccgccgcctggaagttataccaagaagatgcgtgcagggtcttcggtt
ccccgaggaagaacaccaggcaccaaaaaccggagaggacggaaaacactagacacgccg
aacggattctcatctggaaaggcaagaggagagggtacaagagatttccacggaagcccc
tcaagctctgctgggccccaccaggaaggtgatcaggaaggcgtaccatctggtgtggac
cccggaatgcgccctggtccgagtttagtggtagcatcggaagtgtaa

DBGET integrated database retrieval system