KEGG   Tuber melanosporum: GSTUM_00012200001Help
Entry
GSTUM_00012200001 CDS       T01282                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tml  Tuber melanosporum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tml01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tml00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tml00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
INRA: 
UniProt: 
AA seq 499 aa AA seqDB search
MADTEDLIKDTQILGHVQDPHRKILTKECCAFLATLHRTFNATRKQLLHRRVLRQAEIDK
GVLPDFLPETKHIRDNDTWRGADPAPGLVDRRVEITGPIDRKMVVNALNADVWTYMADFE
DSNSPTWDNVINGQINLYDAIRRQVDFKLNGKDYKLRTDRPLPTLIIRPRGWHLDEKHFV
VDGEPISGALFDFGCYFFHNAKQLIQNGHGPYFYLPKMESHLEARLWNDVFNLSQDTVGI
PRGTIRATVLIETILAVFEMDEIIYELRQHSSGLNCGRWDYIYEGVHAMGGMAAQIPIKD
NEEANKKAMAGVYADKLREVRAGHEVNRVAHPALAKIASEVFNKHMPTPNQIFKRREEVS
VTAMDLLNMNMPGAVTEEGIRKNLEIGIGYMEGWLRAVGCVPINYLMEDAATAEVSRSQL
WQWAKHGVSTIEGKRVTKELNLQLLKETTEKLASKAPAGNKYHLAARYFATQITGEDYAD
FLTTLLYNEIVTVGGAAKL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaccgaagacctcatcaaggacactcaaattcttggccatgtgcaagaccct
caccgcaagatccttacgaaagaatgctgtgcattcctagctacccttcatagaacgttc
aatgctacccggaagcagctcctccacagacgtgtgctccgtcaagccgagattgacaag
ggtgtcctccccgacttcctgccggagaccaagcacattcgtgacaatgatacatggcgt
ggagctgatcctgcgcccggcctggtggatcgcagggtggagattaccgggcccattgat
aggaagatggttgttaatgctttgaatgccgatgtttggacttatatggcggattttgaa
gactctaactcgccaacctgggataacgtgattaacgggcaaatcaacttgtacgacgct
atccgccggcaggttgactttaagctcaacgggaaggattacaagctccgcactgaccgt
cctttgccaaccctgattattcgtcctcgtggctggcatcttgacgagaagcactttgtc
gtcgatggcgagccaatctctggcgctctcttcgactttgggtgttacttttttcacaat
gctaagcagttgatccagaacggccacgggccgtacttctacctgccaaagatggaatcg
catctggaggccagattatggaacgatgtattcaatctttctcaggataccgttggaatc
ccaaggggcaccattcgtgctacggtattgatcgagactatcctggctgttttcgagatg
gacgagatcatctatgaattgcggcagcacagctccggtctcaactgcggtcgttgggat
tacatctacgaaggtgttcatgctatgggaggaatggctgcacagattcctatcaaggat
aatgaagaggccaataagaaggctatggctggtgtctatgccgataagctacgagaggtc
agggccggtcatgaagtaaatagggtcgctcaccccgccctcgcaaagatcgcatctgaa
gtcttcaataagcacatgccaacccccaaccaaattttcaagcgcagggaggaagtctct
gtaacagcaatggaccttctcaacatgaacatgccaggcgcagtcacagaggagggaatc
cgcaagaacctagaaatcggcatcggatatatggaaggctggcttcgcgccgtcggttgt
gtgccaataaactacctaatggaggacgccgccaccgccgaagtctcccgttctcaactc
tggcagtgggccaaacacggtgtgagcaccatcgaaggcaagagggtcaccaaagaactg
aacctccagctcctcaaggagaccacagaaaaactcgccagcaaagcgcccgctgggaac
aagtaccaccttgcggcacgctactttgcgacccagatcaccggggaggactatgcggat
ttccttactactctgctgtataacgagattgtaacggtgggtggtgccgcaaaactctga

DBGET integrated database retrieval system