KEGG   Thermotoga maritima: Tmari_0067Help
Entry
Tmari_0067        CDS       T02663                                 

Definition
Endo-1,4-beta-xylanase A precursor (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tmm  Thermotoga maritima
Brite
Enzymes [BR:tmm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Tmari_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(71048..72091)
Genome map
AA seq 347 aa AA seqDB search
MKILPSVLILLLGCVPVFSSQNVSLRELAEKLNIYIGFAAINNFWSLSDAEKYMEVARRE
FNILTPENQMKWDTIHPERDRYNFTPAEKHVEFAEENDMIVHGHTLVWHNQLPGWITGRE
WTKEELLNVLEDHIKTVVSHFKGRVKIWDVVNEAVSDSGTYRESVWYKTIGPEYIEKAFR
WAKEADPDAILIYNDYSIEEINAKSNFVYNMIKELKEKGVPVDGIGFQMHIDYRGLNYDS
FRRNLERFAKLGLQIYITEMDVRIPLSGSEEYYLKKQAEVCAKIFDICLDNPAVKAIQFW
GFTDKYSWVPGFFKGYGKALLFDENYNPKPCYYAIKEVLEKKIEERK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattaccttctgtgttgatccttttgttgggatgtgttccagttttcagctct
cagaatgtatctctgagagaactcgcagaaaagctgaacatctatattggttttgccgca
atcaacaacttttggtctctttccgacgcagaaaagtacatggaagttgcaagaagagaa
ttcaacatcctgacccctgagaaccagatgaagtgggatacgattcatccagaaagagac
agatacaatttcactcccgctgaaaaacacgttgagtttgcagaagaaaacgacatgatc
gtgcatggacacactcttgtctggcacaaccagcttcctggatggatcactggtagagaa
tggacaaaggaagaacttttgaacgttcttgaagaccacataaaaacggtggtgtctcat
ttcaaaggtagagtgaagatctgggatgtggtgaacgaagcggtgagcgattctggaacc
tacagggaaagcgtgtggtacaagacgatcggtcctgaatacattgaaaaagcgttcaga
tgggcaaaagaagccgatccagatgcgattctcatctacaacgactacagcatagaagaa
atcaacgcaaaatcgaacttcgtctacaacatgataaaagagctgaaagaaaagggagta
cctgttgatggaataggatttcagatgcacatagactacagagggctcaattatgacagt
ttcagaaggaatttggagagatttgcgaaactcggtcttcaaatatacatcacagagatg
gatgtgagaattcctctcagtggttcggaggagtattatttgaaaaaacaggctgaagtt
tgtgcgaagatcttcgatatatgcttggacaaccctgcagttaaagcgatccagttttgg
ggattcacagacaaatactcctgggttcccggctttttcaaagggtacgggaaagcgttg
ctcttcgatgagaattacaaccccaagccttgttattacgcgataaaagaggtgctggag
aaaaagatagaagaaagaaaatga

DBGET integrated database retrieval system