KEGG   Thermotoga maritima: Tmari_1018Help
Entry
Tmari_1018        CDS       T02663                                 

Definition
NAD-specific glutamate dehydrogenase / NADP-specific glutamate dehydrogenase (EC:1.4.1.2 1.4.1.4)
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
tmm  Thermotoga maritima
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmm00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Tmari_1018
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tmari_1018
   00330 Arginine and proline metabolism
    Tmari_1018
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Tmari_1018
Enzymes [BR:tmm01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     Tmari_1018
Exosome [BR:tmm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Tmari_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1033322..1034572)
Genome map
AA seq 416 aa AA seqDB search
MPEKSLYEMAVEQFNRAASLMDLESDLAEVLRRPKRVLIVEFPVRMDDGHVEVFTGYRVQ
HNVARGPAKGGIRYHPDVTLDEVKALAFWMTWKTAVMNLPFGGGKGGVRVDPKKLSRNEL
ERLSRRFFSEIQVIIGPYNDIPAPDVNTNADVMAWYMDTYSMNVGHTVLGIVTGKPVELG
GSKGREEATGRGVKVCAGLAMDVLGIDPKKATVAVQGFGNVGQFAALLISQELGSKVVAV
SDSRGGIYNPEGFDVEELIRYKKEHGTVVTYPKGERITNEELLELDVDILVPAALEGAIH
AGNAERIKAKAVVEGANGPTTPEADEILSRRGILVVPDILANAGGVTVSYFEWVQDLQSF
FWDLDQVRNALEKMMKGAFNDVMKVKEKYNVDMRTAAYILAIDRVAYATKKRGIYP
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaaaagcctctacgagatggcagttgaacagttcaaccgtgccgcatcactc
atggatctggaatcagaccttgcagaggttctcagaagaccaaaacgtgttttgatcgtt
gaattcccagtgagaatggatgacggccacgtcgaagtcttcacaggataccgtgtgcag
cacaacgttgcgagaggtccagccaaaggtggtatcaggtaccaccccgatgtcacactc
gatgaggtgaaagccctcgcattctggatgacatggaagactgctgtgatgaatctgcct
ttcggtggagggaagggaggagtcagggtagatccaaagaaactctcaagaaacgagctt
gaaagactctcaagaaggttcttctcagagattcaggtgataataggcccgtacaacgac
atacctgcaccagatgtaaacacgaacgcagatgtgatggcgtggtacatggatacatac
agtatgaatgtgggtcacaccgttttgggaattgtcacaggaaaacccgtggaactggga
ggatcaaagggtcgtgaagaagccacgggtcgtggtgttaaggtgtgtgcagggcttgca
atggatgttctgggaatagatccaaagaaagcaacagttgccgttcagggatttggaaac
gtgggtcagttcgccgctcttttgatttctcaagaactcggatcgaaagtcgttgcggtg
agcgacagcagaggcggtatctacaatcccgaggggttcgacgtggaggagctgatcaga
tacaaaaaagaacacggaacggtcgttacatatccgaagggtgaaagaataaccaacgaa
gaacttctggaactggatgttgacattctcgtccctgcagctttggaaggtgctatccac
gctggaaacgcggaaagaataaaggcaaaagccgtggtggaaggagcaaacggtcccaca
acacctgaagccgacgaaatcctgagcagaagaggaattcttgtggtaccagacatactc
gccaacgccggtggagttacggtttcttactttgaatgggttcaggaccttcagagcttc
ttctgggatttggatcaggtgagaaacgcccttgaaaagatgatgaaaggagcattcaac
gatgttatgaaagtaaaggagaaatacaacgtcgatatgagaacagcagcttacattctt
gcgatcgatcgagttgcgtacgccacgaaaaagagaggtatctatccgtga

DBGET integrated database retrieval system