KEGG   Thermotoga maritima: Tmari_1024Help
Entry
Tmari_1024        CDS       T02663                                 

Definition
Carboxylesterase (EC:3.1.1.1)
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tmm  Thermotoga maritima
Brite
Enzymes [BR:tmm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Tmari_1024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1041663..1042424)
Genome map
AA seq 253 aa AA seqDB search
MNFPRCKTVKKSLPIFLEGGNEGVLFIHGYTGSPHDFEYMAKEVNRAGFTVSVPRLPGHG
TCGEDFLTTTARDWLRRAFDAYYDLKAICDRVYVVGLSMGGVIALILASQMNPPKLVTLA
AATHVFDKRIVLTPILKLFTKKMPCENTEKYEDPDIEYLRKEYWSYNWPKQAAELYKLMK
LARKSVSKITSATLVVAAKNDNMVPMKAAEFIYNNIRSEKRKLLVFEKSGHVLSNDVEKE
DVTRAVIEWLKGE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaattttccacgatgtaaaactgtgaagaagtcgcttccgatctttcttgagggagga
aacgaaggggttcttttcatccatggatacaccggttctccacacgatttcgagtacatg
gcaaaggaggtaaacagagccggctttaccgtttctgttccgagacttccaggacacgga
acctgcggtgaggattttctgacgacaaccgctcgagactggctgagacgcgctttcgat
gcatattacgatttaaaagccatatgcgatagagtctatgtggtgggactttccatgggt
ggtgtgattgctctgatccttgcctctcagatgaatcctcccaaactggtcacactggct
gcagcaactcatgtgttcgacaaaagaatagttctcacaccgattctgaagttgtttacg
aagaagatgccttgtgaaaacacagaaaagtacgaagacccggacatcgaatacctgaga
aaagagtactggtcttacaactggccaaaacaggcagctgagctttacaaactcatgaaa
ctggcaagaaagagtgtttcaaagatcacatcagccactctcgtcgtcgcggcaaaaaac
gacaacatggttcccatgaaggcagccgagttcatatacaacaacatcagatcagaaaag
aggaagcttcttgtttttgaaaaatccggtcacgttctgagcaacgatgtggaaaaggaa
gatgtcaccagagcagttatcgagtggctgaagggggaatga

DBGET integrated database retrieval system