KEGG   Thermotoga maritima MSB8: Tmari_1052Help
Entry
Tmari_1052        CDS       T02663                                 

Definition
(GenBank) Deblocking aminopeptidase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
tmm  Thermotoga maritima MSB8
Pathway
tmm00500  Starch and sucrose metabolism
tmm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tmari_1052
Enzymes [BR:tmm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Tmari_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AGL49976
UniProt: G4FEV0
Structure
PDB: 

Jmol
Position
1063639..1064637
Genome map
AA seq 332 aa AA seqDB search
METGKLLMELSNLDGPSGYETNVVSYIKSVIEPFVDEAKTTRHGSLIGYKKGKGIGKLAF
FAHVDEIGFVVSKVEGQFARLEPVGGVDPKVVYASKVRIYTKNGIERGVIGMLAPHLQDS
ESRKKVLTYDEIFVDLSLCERDVRVGDIAVIDQTAFETNGKVVGKALDNRASCGVLVKVL
EFLKRYDHPWDVYVVFSVQEETGCLGALTGAYEINPDAAIVMDVTFASEPPFSDHIELGK
GPVIGLGPVVDRNLVQKIIEIAKKHNVSLQEEAVGGRSGTETDFVQLVRNGVRTSLISIP
LKYMHTPVEMVDPRDVEELARLLSLVAVELEV
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccggaaaactcttgatggaactgtcgaacctcgacggcccttcaggttacgag
acgaacgtggtttcttacataaagtcagtcattgagcccttcgtggacgaagcgaaaaca
acccgccacggaagtctgatcggatacaaaaagggaaaggggataggaaaactcgcgttt
tttgcccacgtggatgaaatcggttttgttgtttcaaaggtggaggggcaattcgccaga
ctcgagcccgtgggtggagtggatccgaaggtcgtttatgcctcaaaggtgcgaatctac
acaaaaaacgggatcgaacgcggtgtgatcggaatgcttgctccacacctgcaagattcg
gaatccagaaagaaagtcctcacatacgatgaaatcttcgtcgatttatctctgtgtgaa
agagatgttcgtgtaggtgacattgcagtgatagatcagacggctttcgaaacgaatggg
aaggtggtcgggaaggctttggacaacagagcgagctgtggagttcttgtgaaagtactc
gaatttctcaaaagatacgatcacccatgggatgtctatgtggtcttttctgttcaggaa
gagacagggtgcttaggggctctcacaggtgcgtacgagataaatcccgacgcggcgatc
gtgatggacgttacgttcgcttccgagcctccattcagtgatcacatagagcttggaaaa
ggtccggtgataggcctgggaccggttgtggataggaatcttgttcagaagatcatcgag
atagcgaagaaacacaacgtttcccttcaggaagaagcggttggtggaaggtccggcacg
gaaacggatttcgttcagcttgttcgaaacggtgttagaacgtctctcatatccattccc
ttgaagtacatgcacactcccgttgaaatggtggacccgcgcgatgtggaggaactcgct
agacttctctcccttgtcgcggtagaactggaggtgtga

DBGET integrated database retrieval system