KEGG   Thermotoga maritima MSB8: Tmari_1054Help
Entry
Tmari_1054        CDS       T02663                                 

Definition
(GenBank) Endoglucanase M (EC:3.2.1.4)
Organism
tmm  Thermotoga maritima MSB8
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1065657..1066652
Genome map
AA seq 331 aa AA seqDB search
MKELIRKLTEAFGPSGREEEVRSIILEELEGHIDGHRIDGLGNLIVWKGSGEKKVILDAH
IDEIGVVVTNVDDKGFLTIEPVGGVSPYMLLGKRIRFENGTIGVVGMEGETTEERQENVR
KLSFDKLFIDIGANSREEAQKMCPIGSFGVYDSGFVEVSGKYVSKAMDDRIGCAVIVEVF
KRIKPAVTLYGVFSVQEEVGLVGASVAGYGVPADEAIAIDVTDSADTPKAIKRHAMRLSG
GPALKVKDRASISSKRILENLIEIAEKFDIKYQMEVLTFGGTNAMGYQRTREGIPSATVS
IPTRYVHSPSEMIAPDDVEATVDLLIRYLGA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaactgatcagaaagctgacggaagccttcggcccaagtggacgggaagaagag
gtgagaagtatcatcctcgaggaactcgaagggcacatagatggccacaggatcgatggg
ctcggcaatctcattgtctggaaaggaagcggcgagaaaaaggtgatactggacgctcac
atagatgagataggtgttgtcgtcacaaacgtggacgacaagggatttctgacaatagaa
cccgtcggcggtgtctctccgtacatgcttcttggaaaaaggatcaggttcgaaaacggt
acaataggcgttgttggtatggaaggtgaaacaacagaagaaaggcaggagaatgtgaga
aagctctcgttcgacaagctgttcatcgatatcggtgcaaattccagagaagaagcacag
aagatgtgcccaattggaagcttcggtgtctacgacagtggattcgtcgaagtttccggg
aaatacgtctcgaaggcgatggatgacaggataggatgtgccgtgatcgtggaagttttc
aaaagaatcaaacccgctgttacgctctacggtgttttcagtgttcaggaagaagtggga
ctggtcggtgcctcggtggcggggtacggcgtaccagcggacgaggccatcgcgatcgat
gtgactgattcggcagacactccgaaggccatcaagagacacgcaatgaggctctccggt
ggacccgctctgaaagtgaaagacagggcatcgatcagcagcaaacgcatcctcgaaaat
ttgatagaaatcgcggaaaaattcgatataaagtatcagatggaggttctgacgttcggc
ggtacgaacgccatggggtaccagcggactagagaagggattccttcggccacggtgtct
attcccacacgatacgttcactcacccagtgagatgatcgcaccagatgatgttgaggca
acggtcgatcttctcatcaggtatctgggggcgtga

DBGET integrated database retrieval system