KEGG   Togninia minima: UCRPA7_2027Help
Entry
UCRPA7_2027       CDS       T03102                                 

Definition
putative glycoside hydrolase family 13 protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
tmn  Togninia minima
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UCRPA7_2027
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     UCRPA7_2027
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 313 aa AA seqDB search
MGFTACWEGSNNVALPDLRTEDQSVRNFFDPWIASLVSTYKIDGLRIDSAKHQETSFWPT
FSGNSTVYMVGEVYEGDPDVFLPFLSVFPGLLNYPVWYWLQRAFESTSATMTELNTGIAN
IRGKTTKTIYFGSFSENHDQPRMPAWSSQSSDTALIKNAIGFMMLMDGIPIIYQGQEQKL
TGGTVPANREAIWLTGFNTQSELYLWITQINKFRNAAISINSGYASSQATSWTPDSKTIA
LQKGPSGYQTVSVFNNIGSSGSSYSQRKSCIYDDKSAEGLLSLGQAHRLGHLPVADRRHY
FEGIIYGNNFGHT
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgggctttacagcgtgctgggaaggaagcaataatgtagcacttccagacctcaggacc
gaggaccagagtgtacgaaactttttcgatccgtggattgcatcactggtatctacgtac
aaaatcgatggcctgcggatcgatagtgctaaacaccaggagacttctttttggccaacc
ttcagtggtaactcgactgtgtacatggttggcgaagtctatgagggcgatccagatgtg
tttctgcccttcctgagtgtcttccctggattgctcaactatcctgtgtggtactggctc
cagcgtgcctttgagtcgaccagtgccacaatgaccgaactcaacaccggcatcgcaaac
attcgaggcaaaactaccaagactatctactttggttctttcagtgagaatcatgatcaa
ccccgaatgcctgcatggagtagccaatcaagtgacactgcactgatcaagaatgccatc
ggcttcatgatgctcatggatggcattccaatcatctaccagggtcaggaacagaagctc
actggtggcactgtgccggccaatcgcgaggccatctggctcaccggattcaacactcaa
agcgaactgtatctgtggatcactcagatcaataagttcagaaatgcagccatcagcatc
aatagcggctatgcttcctcccaagccacctcatggacacctgatagcaaaacaattgca
ttgcagaaaggtccgtctggctatcagacagtcagcgtcttcaataacatcgggtcgtct
ggcagcagctattctcagcggaaatcttgcatttacgatgacaagtctgccgaaggtctt
ttatcgcttggacaggctcaccggctcgggcatctgcccgtcgctgacaggaggcactac
ttcgaaggcatcatctacggcaacaactttggtcacacgtaa

DBGET integrated database retrieval system