KEGG   Togninia minima: UCRPA7_3045Help
Entry
UCRPA7_3045       CDS       T03102                                 

Definition
putative alkaline phosphatase family protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tmn  Togninia minima
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UCRPA7_3045
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     UCRPA7_3045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 574 aa AA seqDB search
MTVQTTVAQLSSVALRLVSYFFLRWFLPILAFTLFAIYVPSFISSYLTESKYEVVHDEVD
LVIKETTLKGETPEVEDANGDANADDEIIAEEVEVQETIVVGEKPVRGWQSLLTDRLFRE
HTYTADDLSFVRLGYVSDSEAKLLIREPDQSKMPITVELHIKDPQPPFDNPLWQTAGGIR
WTSNETDYTAVLSIPLRHNKQRTYEWRSSNNHSGEFTAAPKAGQTSEITNGQFTFLSTSC
IVSRLPYNPLDHPLAIPGMKYLAKALPDLGAQFMLFLGDFIYVDVPRWWGKDIGDYRQKY
RQVYASPDWAAVGQNLSWIHVLDDHEISNDWSSNDTGVYKAAVEPWHHYHTSVNPPPPKK
AGALARKKPATCNLLPFNDTEKTMLGQEQFEDLLRFLHRPEPKGVKWKVVASSVPFTKNW
HVNTKDTWGGFLTERKKLLEAMWDVGSRGYGVVILSGDRHEFAATKFPPPPDSKWPESAA
VHEFSASPLSQFYSPIPTYKQTDNEDVKVKYVNIGNSKFGAITIENLSEGEQSSLKYRLF
VDGVEAWNTVVLSPQKTIESKASGSFWGRLTGSQ
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgacggtccaaacaactgttgcccagctgtcttccgtcgccttgcgactggtctcttat
ttctttcttcgatggttcctcccgatcctcgcattcacccttttcgcaatctacgtccca
tcctttatttccagttacttgaccgagtcgaaatacgaagttgttcatgatgaagtcgat
ctagttataaaagagactacattgaagggcgagacgcccgaggtggaagatgcaaatggt
gacgccaatgcagatgacgaaatcatagccgaggaggtggaagtacaagagactattgtc
gtcggagaaaagccggtcagaggatggcagtcgctactcacggaccgtttattccgagag
cacacctacaccgccgatgatctctcatttgtccgcctgggatatgtctctgactccgag
gctaagcttctcattcgagagcctgatcagtcgaagatgccaatcacggtagaactgcac
ataaaagaccctcaaccacctttcgacaaccccttatggcagacagcgggtggcattagg
tggacctccaatgagacagactatacggccgttctcagcatccctctcagacacaacaag
cagcggacgtatgaatggaggagctcaaacaaccattcgggcgagttcacagctgcaccc
aaagccggccaaacatcagaaatcaccaatggacaattcacttttctatctacatcttgt
atcgtatcacgactgccatacaatccgctcgatcatcctctagcaattcctggaatgaag
tacctcgccaaagcacttcctgatcttggagcgcagtttatgctatttctcggagacttc
atttacgtagatgtacctcgatggtggggcaaggacatcggagactatcgacagaaatat
cgccaggtctatgcatcaccggactgggctgccgttggccagaatctgagttggattcat
gtccttgacgaccatgagatctcaaatgactggtcttcgaatgatactggtgtgtataag
gctgctgttgagccctggcaccactatcacacgtctgttaatccgcctccaccgaagaaa
gctggtgccttggcgagaaagaagcctgcaacatgtaatttgcttcccttcaatgacact
gagaaaactatgttgggccaggaacagtttgaagacctcctccgcttccttcatcgtcct
gagcccaagggcgtcaaatggaaggttgttgcttcatcggtgccttttacgaagaactgg
catgtgaacactaaagacacatggggtggcttcctaaccgagaggaagaagctccttgaa
gctatgtgggatgtgggctctcgtggatacggcgtggtcatcctctcaggagacaggcat
gaattcgcagctaccaagttcccgcctccgcctgactccaagtggccagagagtgctgcc
gtgcacgagttctctgcgagtccactcagccagttttattctccgatcccgacttacaaa
caaactgataacgaggatgtcaaagtcaaatacgtcaacattggtaactctaaatttgga
gctattaccattgagaacttgagtgaaggcgagcaaagcagcctcaaataccgcctgttt
gtcgatggcgtcgaggcgtggaacaccgtcgtgctgtcgccacagaagacgatcgagtcc
aaggcttccggtagcttctggggtcgcttgactggttcccagtag

DBGET integrated database retrieval system