KEGG   Phaeoacremonium minimum: UCRPA7_6249Help
Entry
UCRPA7_6249       CDS       T03102                                 

Definition
(RefSeq) putative beta- -glucanase protein
  KO
K22276  
glucan endo-1,6-beta-glucosidase [EC:3.2.1.75]
Organism
tmn  Phaeoacremonium minimum
Brite
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.75  glucan endo-1,6-beta-glucosidase
     UCRPA7_6249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 482 aa AA seqDB search
MLFSTTLAILAGEAVYASTVPNLHARVAAAAYCSSSDSAYKLTQFDTPVSGTGTPNGMST
WQLTVDDTSSGYKQKVTGFGASVTDATVTVFNKLSASKLSTLLNTLMTSSGVNFSLLRHT
IASSDLSGDPAYTYDDNGGNADTSLSAFNLGDRGTAMAAMLKAMKALNSGLTILGSPWSA
PGWMKINRKLIGTTVDNNLDHTYASQFAQYFVKYLQAYKNNGVTVDAITIQNEPLNSNAG
FPTMYIFADESGNLIQQNIGPALRNAGLSTQVWAYDHNTDRADYPDTVVNTAPSYVQAAA
WHCYASNNDWGVLTDFHNKHPSVAQYMTECWTSPSTGWSQAADFTMGPLQNWASGALAWT
LGSDTTYGPHLSGDGPCPTCRGLVVVDTTTGNYDFAIDYYMMGQFSKYIPKGATILAGTG
SYTYDDGTGLQSVASLNPDGSKTVVMTNKFSNDIYVTVSLKSGKQWSGRVYKNSVVTWTL
PA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgctattctccactactctcgccatcttggccggcgaggcagtctatgcctcgactgtg
cctaatctgcatgcccgcgtagctgcggctgcttactgctcttcatcggacagtgcgtac
aaactgactcaattcgacacccctgtttctggcacaggaactcccaatggcatgtcaact
tggcagctcaccgtcgacgataccagctcaggctacaagcagaaggtcaccggtttcggt
gcctctgtcactgacgccactgtgactgtattcaacaagctgtcggcgtccaagctctcg
actcttctgaacaccttgatgacatcttccggtgtgaacttcagcctcctccgacacact
attgcctcatctgatctgtctggggaccctgcttacacgtatgatgacaatggaggcaac
gcagacacttccttatcggcattcaaccttggagaccgcggaactgccatggcagctatg
ctcaaggcaatgaaggcactcaattctggattgacaattctgggatctccatggagtgct
ccaggctggatgaagatcaatcggaagcttatcggcaccactgtagacaacaacctcgac
cacacatacgctagccagttcgcacagtacttcgtaaaatacttgcaagcctacaagaac
aatggcgtcacggtcgatgccatcaccattcagaacgagccactcaacagcaatgccggc
ttccctaccatgtacatctttgccgatgagtctggcaatctcattcagcagaacatcggt
cccgctctgagaaatgcaggtctgagcacccaggtctgggcttatgaccataatacagac
cgggctgactaccctgatactgttgtcaatactgcaccaagctacgtgcaagctgcagca
tggcactgttatgcctcaaacaacgattggggagtgttgaccgacttccacaacaaacat
cccagcgtcgcacagtacatgaccgagtgctggacgtcaccgagcactggctggtcacaa
gctgctgacttcaccatgggacctcttcaaaactgggccagcggcgctcttgcatggact
ttgggctctgatacgacttatgggccccatctctctggtgatggcccttgtcctacttgc
cgaggtctggtagtggtcgacaccaccactggcaactacgatttcgcgattgactactac
atgatgggccagttcagcaagtacattcccaaaggcgcaacaatcctcgctggtaccggc
agctatacctatgatgacggcacaggtctgcagagcgtggcttccctcaatcccgatggt
agcaagactgtggtgatgacaaacaaattctccaacgatatctacgtcaccgtgtctctc
aagagcggaaagcagtggagtggccgtgtctacaagaactccgtcgtcacctggacactc
ccagcctag

DBGET integrated database retrieval system