KEGG   Togninia minima: UCRPA7_6249Help
Entry
UCRPA7_6249       CDS       T03102                                 

Definition
putative beta- -glucanase protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tmn  Togninia minima
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    UCRPA7_6249
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    UCRPA7_6249
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     UCRPA7_6249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Unknown
AA seq 482 aa AA seqDB search
MLFSTTLAILAGEAVYASTVPNLHARVAAAAYCSSSDSAYKLTQFDTPVSGTGTPNGMST
WQLTVDDTSSGYKQKVTGFGASVTDATVTVFNKLSASKLSTLLNTLMTSSGVNFSLLRHT
IASSDLSGDPAYTYDDNGGNADTSLSAFNLGDRGTAMAAMLKAMKALNSGLTILGSPWSA
PGWMKINRKLIGTTVDNNLDHTYASQFAQYFVKYLQAYKNNGVTVDAITIQNEPLNSNAG
FPTMYIFADESGNLIQQNIGPALRNAGLSTQVWAYDHNTDRADYPDTVVNTAPSYVQAAA
WHCYASNNDWGVLTDFHNKHPSVAQYMTECWTSPSTGWSQAADFTMGPLQNWASGALAWT
LGSDTTYGPHLSGDGPCPTCRGLVVVDTTTGNYDFAIDYYMMGQFSKYIPKGATILAGTG
SYTYDDGTGLQSVASLNPDGSKTVVMTNKFSNDIYVTVSLKSGKQWSGRVYKNSVVTWTL
PA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgctattctccactactctcgccatcttggccggcgaggcagtctatgcctcgactgtg
cctaatctgcatgcccgcgtagctgcggctgcttactgctcttcatcggacagtgcgtac
aaactgactcaattcgacacccctgtttctggcacaggaactcccaatggcatgtcaact
tggcagctcaccgtcgacgataccagctcaggctacaagcagaaggtcaccggtttcggt
gcctctgtcactgacgccactgtgactgtattcaacaagctgtcggcgtccaagctctcg
actcttctgaacaccttgatgacatcttccggtgtgaacttcagcctcctccgacacact
attgcctcatctgatctgtctggggaccctgcttacacgtatgatgacaatggaggcaac
gcagacacttccttatcggcattcaaccttggagaccgcggaactgccatggcagctatg
ctcaaggcaatgaaggcactcaattctggattgacaattctgggatctccatggagtgct
ccaggctggatgaagatcaatcggaagcttatcggcaccactgtagacaacaacctcgac
cacacatacgctagccagttcgcacagtacttcgtaaaatacttgcaagcctacaagaac
aatggcgtcacggtcgatgccatcaccattcagaacgagccactcaacagcaatgccggc
ttccctaccatgtacatctttgccgatgagtctggcaatctcattcagcagaacatcggt
cccgctctgagaaatgcaggtctgagcacccaggtctgggcttatgaccataatacagac
cgggctgactaccctgatactgttgtcaatactgcaccaagctacgtgcaagctgcagca
tggcactgttatgcctcaaacaacgattggggagtgttgaccgacttccacaacaaacat
cccagcgtcgcacagtacatgaccgagtgctggacgtcaccgagcactggctggtcacaa
gctgctgacttcaccatgggacctcttcaaaactgggccagcggcgctcttgcatggact
ttgggctctgatacgacttatgggccccatctctctggtgatggcccttgtcctacttgc
cgaggtctggtagtggtcgacaccaccactggcaactacgatttcgcgattgactactac
atgatgggccagttcagcaagtacattcccaaaggcgcaacaatcctcgctggtaccggc
agctatacctatgatgacggcacaggtctgcagagcgtggcttccctcaatcccgatggt
agcaagactgtggtgatgacaaacaaattctccaacgatatctacgtcaccgtgtctctc
aagagcggaaagcagtggagtggccgtgtctacaagaactccgtcgtcacctggacactc
ccagcctag

DBGET integrated database retrieval system