KEGG   Tistrella mobilis: TMO_0084Help
Entry
TMO_0084          CDS       T02128                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tmo  Tistrella mobilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tmo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(84008..84784)
Genome map
AA seq 258 aa AA seqDB search
MRILVTRPIDDAQTLAEQLHRLGHQAVIAPLMTVRYRPIPDLERVLDRAQRVLLTSANGA
RALARATDRRDLKLATVGRATAEAAKRAGFTRIDVAGGDADRLAELCANSYKPEDGPLAH
IAGSVVTGRLGEQLGALGFTVERRVGYDAAAIGELPPPVAEGLAQGQLPVVMLFSPRTAR
LFLDEIERLGIGASFCRIDALCLSPAVAEMAAGLPWRRLLVAAEPAGDAMLALLDQAGPN
SQAPNPQATPPQSAMPQG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcctggtgacccgtccgatagacgacgcacagacgctcgcggaacagttgcat
cgcctgggacaccaggcggtgatcgcacccctgatgaccgtccgctaccggccgatcccc
gatcttgaacgggtgctggaccgggcgcagcgggtgctgctgaccagcgccaacggcgcc
cgggcgctggcacgggcgaccgaccgtcgcgatctgaaactggccaccgtcggccgcgcc
accgccgaggcggcgaagcgtgccggcttcacccgcatcgatgtcgccggcggcgacgcc
gaccggctggcggaactctgtgccaattcctacaaacccgaagacggcccgcttgcccat
atcgccggcagcgtggtcaccgggcggctgggagagcagctgggcgcgctgggcttcacc
gtcgagcgccgggtcggctatgacgccgccgcgatcggcgagctgccgccgccggttgca
gaggggctggcacagggccagctgccggtggtgatgctgttctcgccccgcacggcccgg
ctgttcctggacgagatcgaacgcctgggcatcggcgcgtccttctgtcgcatcgatgcg
ctgtgcctgagcccggccgtggcagagatggccgccggcctgccctggcggcggctgctg
gtcgccgccgaacccgcaggggatgcgatgctggcgctgctcgatcaggccggccccaat
tctcaggcgcccaacccgcaggccacgccccctcaatccgccatgccgcagggctga

DBGET integrated database retrieval system