KEGG   Tistrella mobilis: TMO_0404Help
Entry
TMO_0404          CDS       T02128                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tmo  Tistrella mobilis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TMO_0404
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TMO_0404
Enzymes [BR:tmo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TMO_0404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
442138..442779
Genome map
AA seq 213 aa AA seqDB search
MTIARILAAGIAVTAAATIAAVAVLPASALPRSTGGEASKHATAEATGMTAYDFSLPAID
GGTIDMAAWRGQPLLIVNTASLCGFTRQYEGLVKLWQDYRDRGLVVVGVPSGDFGGQEYD
EAGRTKEFCTVTYGVDFPLAEKQTVRGSEAHPLFRWLTASLGEDAAPRWNFHKYLIDAQG
RAVKSWPSRVEPTDREIVSAIEAVLPQRQARLN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgccaggatcctggcggcagggatcgcggtgacggcagcggcgacgatcgcg
gcggtcgcagtgctaccggcctctgcgctgccgcgcagcaccggcggcgaggcatcgaaa
catgcgacggcggaggcgaccggtatgacggcctatgatttttccctgccggccatcgat
ggcggcaccatcgacatggcggcctggcgcggccagccgctgctgatcgtcaacaccgcc
tcgctctgcggcttcacccggcagtatgaggggctggtgaagctctggcaggactatcgc
gaccgtggcctggtggtggtcggtgtcccctcgggtgatttcggcggccaggaatacgac
gaggccggtcgcaccaaagaattctgcaccgtcacctatggcgtcgatttcccgctggct
gaaaagcagacggtgcgcggcagcgaggcgcatccgctgtttcgctggctgaccgcctcg
ctcggcgaggacgcggcgccgcgctggaatttccacaaatacctgatcgatgcccagggg
cgggcggtgaagagctggccctcgcgggtggagccgaccgatcgtgagatcgtctcggcg
atcgaagccgtcctgcctcagcggcaggccagactgaactga

DBGET integrated database retrieval system