KEGG   Tistrella mobilis: TMO_0437Help
Entry
TMO_0437          CDS       T02128                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tmo  Tistrella mobilis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TMO_0437
  Amino acid metabolism
   00340 Histidine metabolism
    TMO_0437
Enzymes [BR:tmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     TMO_0437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484499..485821
Genome map
AA seq 440 aa AA seqDB search
MPAVNLHDLSTLDAAARADLLKRAESDLGPFLDKVRPIIEAVRTEGDAALARFARDFDRA
PVDPARIRVEPEAFDRAFDQVEPEVIEAIRFAVDNIRRFHQDQKPEEMWLHEVRPGAFAG
DRFLPIPSVACYVPRGKGSFPSVVMMTTVPAVVAGVPEISIITPPGPDGEVDAATLVAAR
LAGVETVYKCGGAQGVAAVAYGTETVRKAVKIVGPGSPWVVAAKRLLSDVIDPGIPAGPS
EAIIFADDTADGRLAALDLLVEAEHGPDSSAYLVTTSRKVAEDAIVALDGYWAKMGKQRR
GFSTTVLTGPRGGVVLAPDLEAAYAFVNDYAPEHLEVLGDEPFAHLGRLVNAGEILLGNR
TPVTLGNFVLGPNAVLPTNAAARTFSPLSVFDYMKRSSVGYVTARAYPELARHAGVLARY
EGFEAHAAAVSEVRDALLKR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgtcaacctccacgacctttcgaccctcgacgccgccgcccgcgccgacctg
ctcaagcgcgccgaaagcgatctcggccccttcctcgacaaggtccggccgatcatcgaa
gcagtgcgcaccgagggagatgcggcgctggcccgtttcgcccgtgatttcgacagggcg
cctgtcgatccggcccggatccgggtcgagcccgaggccttcgaccgggccttcgatcag
gtcgagcccgaggtgatcgaggcgatccgctttgcggtcgacaacatccgccgcttccat
caggaccagaagcccgaggagatgtggctgcacgaggtgcgccccggtgcctttgccggt
gaccgcttcctgccgatcccgtcggtcgcctgctatgtgccgcggggcaagggctcgttt
ccgagcgtggtgatgatgaccacggtgccggcggtggtggcgggcgtgcccgagatttcg
atcatcacaccgcccggccccgatggcgaggtcgatgcggcgacgctggttgcggcacgg
ctcgccggtgtcgagacggtctacaaatgcggtggcgctcagggtgtcgcggcggtagcc
tatggcaccgaaaccgtccgcaaggcggtgaagatcgtgggccccggcagcccctgggtg
gtggcggccaagcgcctgctgtcggatgtgatcgatcccggcatccccgccgggccgagc
gaggcgatcatcttcgccgacgatacggcggatggacggctggcggcgctcgacctgctg
gtcgaggcggagcacggccccgacagctcggcctatctggtcaccaccagccgcaaggtc
gccgaggatgcgatcgtggccctcgacggatactgggcgaagatgggcaagcagcgccgc
ggcttctcgaccaccgtgctcaccggtccgcgcggtggcgtggtgctggcgccggatctg
gaagcggcctatgccttcgtcaacgactatgcgccggaacatctggaagtgctgggcgac
gagcccttcgcccatctgggacggctggtgaatgcgggcgagattctgctcggcaaccgt
accccggtgacgctcggcaatttcgtgctcgggcccaatgccgtgctgccgaccaatgcc
gccgcccgcaccttctcgccgctatcggtcttcgactacatgaagcggtcctcggtcggc
tatgtcaccgcccgggcctatccggagcttgcccgccatgccggcgtgctggcccgctac
gagggcttcgaggcccatgccgccgcggtctccgaagtgcgcgacgcgctgctgaagcgc
tga

DBGET integrated database retrieval system