KEGG   Tistrella mobilis: TMO_0577Help
Entry
TMO_0577          CDS       T02128                                 

Gene name
exoN
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tmo  Tistrella mobilis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TMO_0577 (exoN)
   00052 Galactose metabolism
    TMO_0577 (exoN)
   00500 Starch and sucrose metabolism
    TMO_0577 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    TMO_0577 (exoN)
Enzymes [BR:tmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TMO_0577 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645077..645976
Genome map
AA seq 299 aa AA seqDB search
MSNTKPVRKAVFPVGGLGTRFLPATKAMPKEMLPVVDKPLIQYAVEEARAAGIEELIFVT
GRNKTAIEDHFDQSFELEWTLQERGKHDQLTQLRRWLPKAGNVSYTRQQEPMGLGHAVWC
ARHLVGNEPFAVLLADDLVLADRPCLSQMVEVYEQKGGNVVAAMDVAPEHTSRYGIIDIA
QDDGRLVTARGMVEKPKSDEAPSRTAVIGRYILQPEIFDHLGRHERGSGGEIQLTDAIRA
MVESHPFHAVRFDGERFDCGDKAGFIQANIAFSLARVDLRDQVKDFLAERLSTYRDAAQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccaagcccgttcgcaaagccgtcttccccgtcggtggcctgggcacgcgc
ttccttccggccaccaaggccatgcccaaggaaatgctgccggtcgtcgacaagccgctg
atccagtacgccgtggaagaggcgcgtgccgccggcatcgaagagctgatcttcgtcacc
ggccggaacaagaccgccatcgaagaccatttcgaccagtcgtttgaactggagtggacg
ctgcaggagcgcggcaagcacgaccagctgacccagctgcgccgctggctgccgaaggcc
ggcaatgtgtcctatacccgccagcaggagccgatgggcctgggccatgccgtgtggtgc
gcccggcatctggtcggcaacgagcccttcgccgtgctgctggccgacgatctggtcctt
gccgaccgcccgtgcctcagccagatggtcgaggtctacgagcagaagggcggcaatgtc
gtggctgcgatggatgtcgcccctgagcacacctcgcgctatggcatcatcgacatcgcc
caggatgatggccgtctggtcaccgcccgcggcatggtcgagaagccgaaatccgacgag
gcgccttcgcgcaccgcagtgatcggtcgctacatcctgcagcccgagatcttcgatcat
ctgggccgccacgagcgcggttcgggcggcgagatccagctgaccgacgcgatccgcgcc
atggtcgaaagccaccccttccatgcggtgcgcttcgatggcgagcgcttcgattgcggc
gacaaggccggcttcatccaggcgaatatcgccttctcgctggcccgcgtcgatctgcgc
gaccaggtgaaggacttcctggccgagcgcctttcgacctaccgcgacgccgcccagtaa

DBGET integrated database retrieval system