KEGG   Tistrella mobilis: TMO_0577Help
Entry
TMO_0577          CDS       T02128                                 

Gene name
exoN
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tmo  Tistrella mobilis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TMO_0577 (exoN)
   00052 Galactose metabolism
    TMO_0577 (exoN)
   00500 Starch and sucrose metabolism
    TMO_0577 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    TMO_0577 (exoN)
Enzymes [BR:tmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TMO_0577 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
645077..645976
Genome map
AA seq 299 aa AA seqDB search
MSNTKPVRKAVFPVGGLGTRFLPATKAMPKEMLPVVDKPLIQYAVEEARAAGIEELIFVT
GRNKTAIEDHFDQSFELEWTLQERGKHDQLTQLRRWLPKAGNVSYTRQQEPMGLGHAVWC
ARHLVGNEPFAVLLADDLVLADRPCLSQMVEVYEQKGGNVVAAMDVAPEHTSRYGIIDIA
QDDGRLVTARGMVEKPKSDEAPSRTAVIGRYILQPEIFDHLGRHERGSGGEIQLTDAIRA
MVESHPFHAVRFDGERFDCGDKAGFIQANIAFSLARVDLRDQVKDFLAERLSTYRDAAQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccaagcccgttcgcaaagccgtcttccccgtcggtggcctgggcacgcgc
ttccttccggccaccaaggccatgcccaaggaaatgctgccggtcgtcgacaagccgctg
atccagtacgccgtggaagaggcgcgtgccgccggcatcgaagagctgatcttcgtcacc
ggccggaacaagaccgccatcgaagaccatttcgaccagtcgtttgaactggagtggacg
ctgcaggagcgcggcaagcacgaccagctgacccagctgcgccgctggctgccgaaggcc
ggcaatgtgtcctatacccgccagcaggagccgatgggcctgggccatgccgtgtggtgc
gcccggcatctggtcggcaacgagcccttcgccgtgctgctggccgacgatctggtcctt
gccgaccgcccgtgcctcagccagatggtcgaggtctacgagcagaagggcggcaatgtc
gtggctgcgatggatgtcgcccctgagcacacctcgcgctatggcatcatcgacatcgcc
caggatgatggccgtctggtcaccgcccgcggcatggtcgagaagccgaaatccgacgag
gcgccttcgcgcaccgcagtgatcggtcgctacatcctgcagcccgagatcttcgatcat
ctgggccgccacgagcgcggttcgggcggcgagatccagctgaccgacgcgatccgcgcc
atggtcgaaagccaccccttccatgcggtgcgcttcgatggcgagcgcttcgattgcggc
gacaaggccggcttcatccaggcgaatatcgccttctcgctggcccgcgtcgatctgcgc
gaccaggtgaaggacttcctggccgagcgcctttcgacctaccgcgacgccgcccagtaa

DBGET integrated database retrieval system