KEGG   Tistrella mobilis: TMO_0582Help
Entry
TMO_0582          CDS       T02128                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tmo  Tistrella mobilis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TMO_0582
Enzymes [BR:tmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TMO_0582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(651364..652335)
Genome map
AA seq 323 aa AA seqDB search
MLVFGSVNQDLVLACRHLPTAGETVAARDPLHLPGGKGGNQAFAAARAGARVSLIAAVGD
DAAADIALGGLAAAGCDMSGVIRTHRPTGLAIVAVGPRRAGDDRTDNQIIVSPGANDDLD
DAAVADALLANAVLVTQNETPAAGIGRLHARAAASGAVVVHNAAPARGADDLPMAPVNHL
VVNETEWAAFAGATLDPDAPDAALAAAIRSGRSAAGLRPDQLVVMTLGAAGALIADAATL
VRQPSAPVAVVDSTGAGDAFVGAYAAALARGAEAARALAEGVAAGGLACAALGARAATPD
AAAIRRAAAALPAAHRIPLAPVS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtcttcggctcggtcaatcaggatctggtgctcgcctgccggcatctgccgacg
gcgggagagactgtcgccgcccgcgacccgctgcatctgccgggcggcaagggcggcaac
caggccttcgccgccgcccgtgccggtgcccgcgtctctctgattgccgcggtcggcgac
gatgcagcggccgatattgccctgggcggcctggccgccgccggttgcgacatgtccggc
gtgatccgcacgcatcgccccacgggcctcgcaatcgtcgccgtcgggccgcgccgggcg
ggggatgatcgcaccgacaaccagatcatcgtctccccgggcgccaatgacgatctggac
gatgcggcggtggccgatgcgctgctcgcaaatgccgtactggtcacccagaacgaaacc
cccgccgccggtatcggccgtctgcacgcccgggcggcggcatcgggggccgtggtcgtc
cacaatgccgccccggcccgtggggcggatgacctgccgatggcgccggtaaaccatctg
gtggtcaacgaaaccgaatgggcggccttcgccggtgcgacactcgatcccgatgcgccc
gatgcggccctggccgccgccatccggtccggccgcagcgccgccgggctgcggccggat
cagctggtggtcatgaccctgggggccgccggtgcgctgatcgcagacgcagccactctg
gtgcgccagccatcggcccctgtcgccgtggtcgacagcaccggagcgggcgacgccttc
gtcggcgcctatgccgccgccctcgcccgtggcgcggaggcagcccgggccctggccgag
ggggtggcagccggcgggctcgcctgtgccgccctgggggcgcgcgccgccacccccgat
gccgcggcgatccgcagggcagcggcggccctgccggccgcacaccgcatcccccttgcc
ccggtcagctga

DBGET integrated database retrieval system