KEGG   Tistrella mobilis: TMO_0816Help
Entry
TMO_0816          CDS       T02128                                 

Gene name
pldB
Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
tmo  Tistrella mobilis
Pathway
tmo00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TMO_0816 (pldB)
Enzymes [BR:tmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TMO_0816 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Peptidase_S9 Abhydrolase_3 Abhydrolase_4
Motif
Other DBs
NCBI-ProteinID: AFK52655
UniProt: I3TIR7
Position
904706..905701
Genome map
AA seq 331 aa AA seqDB search
MDFDAVAAARAALASVTVPPAPQGPEADQADLLDRPDGMVIRYLIWHPAPGMPPRGTVLL
LQGRGEFVEKYAELAGWLRAAGWAVFAPDWRGQGRSGRLAPDRAMGHLNRFDDCLDDLDA
LAAGPLAGLPRPLVMLGHSMGGHLGMRWVLERVPAVARPAAIILSAPMIDIRMPLPARRL
VPPLARLMRARGRGMTYAPGQGPGRASGGGFAGNRLTHDPARWAREQALLAADPALHLGG
SSWGWLAAAFDSIRDLERAVIRAGAGLDVPVTLLQGGADMVVDPVAQSRLVARLPRARLV
VVPGALHEILMETDEIQAPARAAITQALEGI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgacgccgttgcggccgcccgggccgcgctcgcctcggtgacggtgcccccc
gcgccccaggggcccgaggcagatcaggccgatctgctcgaccggccggacggcatggtg
atccgctatctgatctggcatccggcccccgggatgccgccgcgcggcacggtgctgctg
cttcaggggcgcggtgaattcgtcgagaaatatgccgagctggccggatggttgcgggcg
gcgggctgggcggtcttcgcccccgactggcgcggacagggccggtccggccggcttgcc
cctgatcgggccatggggcatctgaaccggttcgacgactgcctggacgatctggatgcg
ctggcggcggggccgcttgccggcctgccgcggccgctggtgatgctgggccattccatg
ggcggccatctgggcatgcgctgggtgctggaacgggtgccggccgtggcacggccggcg
gccattatcctgtcggcgccgatgatcgacatccgcatgccgctgccggcccggcggctg
gtgccgccgctggcgcggctgatgcgcgcccgcggccgcggcatgacctatgcccccggc
caggggccggggcgggccagcggcggcggtttcgccggcaaccggctgacccatgatccg
gcgcgctgggcgcgggaacaggcgctgctggcggccgatcccgccctgcatctgggcggc
agcagctggggctggctggcggcggccttcgattcgatccgcgatctggagcgggcggtg
atccgtgcgggcgcagggctggatgttccggtcaccctcttgcagggcggcgccgatatg
gtggtcgacccggtcgcgcagtccaggctggtggcgcggctgccccgcgcccggctggtg
gtggtgccgggggcgctgcacgagatcctgatggaaaccgacgagatccaggcccccgcc
cgggcggcgatcacgcaggccttggaaggcatctga

DBGET integrated database retrieval system