KEGG   Tistrella mobilis: TMO_0816Help
Entry
TMO_0816          CDS       T02128                                 

Gene name
pldB
Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
tmo  Tistrella mobilis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TMO_0816 (pldB)
Enzymes [BR:tmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TMO_0816 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
904706..905701
Genome map
AA seq 331 aa AA seqDB search
MDFDAVAAARAALASVTVPPAPQGPEADQADLLDRPDGMVIRYLIWHPAPGMPPRGTVLL
LQGRGEFVEKYAELAGWLRAAGWAVFAPDWRGQGRSGRLAPDRAMGHLNRFDDCLDDLDA
LAAGPLAGLPRPLVMLGHSMGGHLGMRWVLERVPAVARPAAIILSAPMIDIRMPLPARRL
VPPLARLMRARGRGMTYAPGQGPGRASGGGFAGNRLTHDPARWAREQALLAADPALHLGG
SSWGWLAAAFDSIRDLERAVIRAGAGLDVPVTLLQGGADMVVDPVAQSRLVARLPRARLV
VVPGALHEILMETDEIQAPARAAITQALEGI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggatttcgacgccgttgcggccgcccgggccgcgctcgcctcggtgacggtgcccccc
gcgccccaggggcccgaggcagatcaggccgatctgctcgaccggccggacggcatggtg
atccgctatctgatctggcatccggcccccgggatgccgccgcgcggcacggtgctgctg
cttcaggggcgcggtgaattcgtcgagaaatatgccgagctggccggatggttgcgggcg
gcgggctgggcggtcttcgcccccgactggcgcggacagggccggtccggccggcttgcc
cctgatcgggccatggggcatctgaaccggttcgacgactgcctggacgatctggatgcg
ctggcggcggggccgcttgccggcctgccgcggccgctggtgatgctgggccattccatg
ggcggccatctgggcatgcgctgggtgctggaacgggtgccggccgtggcacggccggcg
gccattatcctgtcggcgccgatgatcgacatccgcatgccgctgccggcccggcggctg
gtgccgccgctggcgcggctgatgcgcgcccgcggccgcggcatgacctatgcccccggc
caggggccggggcgggccagcggcggcggtttcgccggcaaccggctgacccatgatccg
gcgcgctgggcgcgggaacaggcgctgctggcggccgatcccgccctgcatctgggcggc
agcagctggggctggctggcggcggccttcgattcgatccgcgatctggagcgggcggtg
atccgtgcgggcgcagggctggatgttccggtcaccctcttgcagggcggcgccgatatg
gtggtcgacccggtcgcgcagtccaggctggtggcgcggctgccccgcgcccggctggtg
gtggtgccgggggcgctgcacgagatcctgatggaaaccgacgagatccaggcccccgcc
cgggcggcgatcacgcaggccttggaaggcatctga

DBGET integrated database retrieval system