KEGG   Tistrella mobilis: TMO_0856Help
Entry
TMO_0856          CDS       T02128                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tmo  Tistrella mobilis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tmo00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:tmo00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
949225..950004
Genome map
AA seq 259 aa AA seqDB search
MNLKGKTALVTGSTSGIGLAIARALAAAGADLVLNGFGDAAQIEALVAEIQAEAGVKVVY
DGADMSKPAEIEALFANAAPNGIDILVNNAGIQHVAKIEDFPVEQWDRIIAINLSSAFHT
SRLALPGMKAKGWGRILNIASAHGLVASAEKSAYVAAKHGIVGLTKVTALETAETGVTCN
AICPGWVRTPLVERQIEAKSKEHGISIEEASRDLLAEKQPTLRFTTPEQLGGVAVFLCSA
AADNITGISLPVDGAWTAR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcaagggtaagaccgcgctcgtcaccgggtcgaccagcggtatcgggctggcc
atcgcccgcgcgctggccgcggccggcgccgatctggtcctgaacggtttcggcgacgca
gcgcagatcgaggcgctggtggccgagatccaggccgaggccggggtgaaggtcgtctat
gacggcgccgatatgagcaagcccgccgagatcgaggccctgttcgccaatgcggccccg
aacgggatcgacattctggtcaacaatgccggcatccagcatgtggcgaagatcgaggat
ttcccggtcgagcagtgggaccggatcatcgccatcaacctgtcctccgccttccacacc
agccggctggcactgccgggcatgaaggccaagggctggggccggatcctgaacatcgcg
tccgctcatggtctggtcgcctcggccgagaagtcggcctatgtggcggccaagcacggc
atcgtcggcctgaccaaggtcaccgcgcttgagaccgccgagaccggcgtcacctgcaat
gcgatctgcccgggctgggtgcgtacgccgctggtcgagcgccagatcgaggccaagtcc
aaggagcacggcatttcgatcgaggaagccagccgcgacctgctggccgagaagcagccg
accctgcgcttcaccaccccggaacagctgggtggcgtggcggtcttcctgtgcagtgcc
gctgccgacaacatcaccggcatctcgctgccggtcgatggtgcctggaccgcccgctga

DBGET integrated database retrieval system