KEGG   Tistrella mobilis: TMO_0912Help
Entry
TMO_0912          CDS       T02128                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tmo  Tistrella mobilis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TMO_0912 (folP)
Enzymes [BR:tmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TMO_0912 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1002461..1003666
Genome map
AA seq 401 aa AA seqDB search
MAHDLPANAAAASSDAAAAASLETRIREGDAGLRLYARPFGFAPVAVTPGAGLLKPATRL
PGPGFRRLAGGWLAFDMVELLWRGGEGRPGRVVLPVEAALRLADRVMEYPGGRRLARRLR
ALEAPRQRFAGLDLQRRARVMAIVNVTPDSFSDGGDAFAPADAAAAVRRALADGADLLDL
GAESTRPGAADIDPAEEIRRLDPALDEASAAGAVVSVDTRKGAVMHHAAGRGAAIANDVS
GFTYDPAAAGVVAQTGLSAVAMHMRGTPETMQQLTGYDDVVLDVFDELEDRLVLLDEAGV
SPGQVAVDPGIGFSKTVDQNLALLHNLSIFHGLGRPLLIGVSRKSFIGRITGEEAPRARV
PGSLAAALLAVGQGAQIVRVHDVAETVQALVVGQAIGRGRA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttggcccatgacctgcctgccaacgctgcggccgcatcttcggatgcggccgcagccgcg
tctctggagacccgcatccgcgagggcgatgcgggtcttcgtctgtatgcccgccccttc
ggttttgcgccggtcgcggtcaccccgggggcggggcttctgaaacccgccacgcgcctg
ccggggccgggcttccggcgcctggcgggcggttggctcgccttcgacatggtggagctg
ctctggcggggcggggagggccgcccggggcgggtggtgctgccggtagaggcggcactc
aggctcgccgaccgggtgatggaatatccgggtggccggcgtctggcccggcgtctgcgg
gcgctggaggccccccgccagcgctttgccgggctcgatctgcagcgccgcgcccgggtg
atggcgatcgtgaacgtcacgcccgacagtttttcggatggcggcgacgcctttgcgccc
gccgatgccgcagcggccgtccgccgggcgctggccgatggcgccgatctgctggatctg
ggcgccgaatcgacccgccccggcgccgccgatatcgacccggccgaagagatccggcgg
ctggatccggcgctggacgaggcgtcggccgccggggccgtggtctcggtcgatacccgc
aagggcgccgtgatgcaccatgccgccggccgcggtgccgccatcgccaacgatgtcagc
ggcttcacctacgaccccgcggcggcgggggtggtggcacagacggggctctcggccgtt
gccatgcatatgcgcggcacgccggaaaccatgcagcagctgaccggctatgacgatgtg
gtgctcgatgtcttcgacgaactcgaggatcggctggtcctgctcgacgaggcgggggtg
tcgccggggcaggtggcggtcgatcccgggatcggattttcaaagacggtggaccagaat
ctcgctctgttgcataacctgtcgatctttcacggccttggccgccccctgctgatcggc
gtgtcgcgcaagagcttcatcggccggatcaccggcgaagaggcgccccgggcgcgtgtg
ccgggctcgcttgccgccgctctgctcgcggtcggccagggcgcccagatcgtgagggtg
catgacgtggctgaaacggttcaggcgctggtggtcggccaggcaatcggccgcggccgg
gcgtag

DBGET integrated database retrieval system