KEGG   Tistrella mobilis: TMO_1082Help
Entry
TMO_1082          CDS       T02128                                 

Gene name
celY
Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tmo  Tistrella mobilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TMO_1082 (celY)
Enzymes [BR:tmo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TMO_1082 (celY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1191689..1192993)
Genome map
AA seq 434 aa AA seqDB search
MSSRSRVISLAVIAAIAFAVWATTKSRTPDGTAEAGTTSALPAPRALAAAATPAIVPVSS
EGQAIPKDRAQLQTPAPADTPPVQTARAEAPRTEADRKAGLDADTVALWEDWRQRFLTPE
GRVIDTGNGGISHSEGQGYGLLLSVLMGDRASFARIWSWTYTTLFVRDDGMMAWRYDPKA
DPAVTDRNSASDGDILAAWALAEAGRRWSDDRYREAAAELAAAIRRTVIVEHAGRLMVLP
GQEGFRRDPSVVVNPAYWVLPAFPVLADIDPDGAAIWNRLAAETPAVMAAVRFGTPALPP
EWVVAEPDGAFTLPQDPNFPAAFGYNAVRVPLYLAWAGVLDPALPIYVDLDRLWPAGAAR
IADRPQVVALPDGRVTERGSDAGFRAVAGLVACIVHDRPMPADVTAVDDDASYYAASLTL
MVRLAAAGRKPACL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccgttcccgcgtgatcagcctggcggtgatcgccgcgatcgcctttgcggtc
tgggcgaccaccaaaagccgcacgccggacggcaccgcagaggccgggacgacatcggcc
ctgccggccccgcgtgccctggctgcggcggcgacgccggcgatcgtgcccgtctcgtca
gagggacaagccataccgaaagaccgggcacagctgcagacccctgcccctgccgatacc
ccgccggttcaaacggcgcgcgccgaagccccgcggaccgaggccgatcgaaaggcgggg
ctggatgcggacaccgtggccctgtgggaagactggcggcagcgctttctcacccccgaa
ggccgggttatcgacaccggcaatggcggcatcagccattcggaaggccagggctatggc
ctgctgctgtcggtgctgatgggcgaccgggccagtttcgcgcggatctggtcgtggaca
tataccacgctgttcgtgcgcgatgacggcatgatggcctggcgctacgaccccaaggcc
gatccggcggtgaccgatcgcaacagcgcgtcggacggcgacattctggcggcctgggca
ctggccgaagcggggcggcgctggagcgacgatcgctatcgcgaggcggcggcagaactt
gccgccgcgatccgccgcaccgtgatcgtggagcatgccgggcggctgatggtcctgccc
ggccaggaaggcttccgccgcgacccgtcggtggtcgtgaacccggcctattgggtgctg
ccggccttcccggttctggccgacatcgatccggacggcgccgcgatctggaaccggctt
gccgccgaaaccccggctgtcatggccgccgtgcggttcggcaccccggccctgccgccc
gaatgggtggtggcagagcctgacggcgccttcaccctgccgcaggatccgaatttcccc
gccgccttcggctacaacgccgtgcgggtgccgctgtatctggcctgggccggggtgctg
gaccctgccctgccgatctatgtcgatctcgaccggctctggccggccggggccgcccgc
atcgccgaccggccgcaggtcgtggccctgcccgacggcagggtcaccgagcgcggcagc
gatgccggtttccgcgccgtggccggcctggtcgcctgtatcgttcacgaccggccgatg
ccggccgatgtcaccgccgtcgacgacgacgcctcgtattacgcggccagcctgaccctg
atggtccgccttgccgccgccgggaggaagcctgcatgcctgtga

DBGET integrated database retrieval system