KEGG   Tistrella mobilis: TMO_1226Help
Entry
TMO_1226          CDS       T02128                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tmo  Tistrella mobilis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:tmo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tmo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1345820..1347007
Genome map
AA seq 395 aa AA seqDB search
MVVDDSAVIRGLFIRVLEADPEIRVVASAANGRIALNQLKRQPVEVVVLDIEMPEMDGLT
ALPELVRAQPGLKVIMASTLTRKNAAVSMEALAKGAVDYIPKPSATSEVYSNEGFSRELL
AKVKAHADRGRRDGTAPALGGGAAAPAAPAAAASPTTAYRPRTEPAAPAARPAAVPAAAA
DLPQRLGLQRKPVVLRPFPPAFRAKALAVGSSTGGPQALFTLFGALGPALQRIPVFITQH
MPATFTTILAEHLARASGLPCVEAEDGMPVKAGRIHVARGDWHMVPTEAAGGAVIRINQD
APENFCRPAVDPMLRGLAKIYGRNLLTVILTGMGSDGQRGGEHVVQAGGVVMAQDEASSV
VWGMPGAAAQAGLCSAVLPLDRMAGEVRRLVDGGP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcgacgacagcgcggtcattcgcggtctgttcatccgtgtcctagaagccgat
cccgagatccgtgtcgtcgcctctgccgcgaatggtcggatcgcactcaaccagctgaag
cgccagccggtggaagtggtcgtgctcgacatcgagatgccggaaatggacggtctgacc
gccttgccggagctggtgcgggcgcagcccgggctcaaggtcatcatggcctccacgctg
acccgcaagaatgcggcggtcagcatggaggccctggccaagggcgcggtcgactacatt
cccaagcccagcgccaccagcgaggtctactcgaacgagggtttctcgcgcgagctgctg
gccaaggtgaaggcccatgccgatcgcggtcgtcgcgacggcacggcgccggcactcggt
ggcggtgccgccgcaccggcggcacctgccgctgccgccagcccgaccacggcctatcgt
ccgcggaccgagccggcggcacctgccgcacgtccggccgcggtgccggccgcggcggcg
gatctgccgcagcggctgggtctgcagcgcaagcccgtggtgctgcgcccgttcccgccg
gccttccgggccaaggcgctggcggtcggcagttccaccggcggcccgcaggcgctgttc
accctgttcggagcgctggggcccgcattgcagcggattccggtgttcatcacccagcac
atgcccgccaccttcaccaccatcctggccgagcatctggcccgcgcaagcggcctgccc
tgcgtcgaggccgaggacggcatgccggtgaaggccggtcgcatccacgtcgcccgcggt
gactggcacatggtgccgaccgaagcggccggcggggcggtgatccggatcaaccaggac
gcgccggagaatttctgccggccggcggtggatccgatgctgcgggggctggcgaagatt
tatggccgcaacctgctgaccgtgatcctgaccggtatggggtcggacgggcagcgtggt
ggcgaacatgtcgtgcaggcaggcggcgtggtcatggcccaggacgaggcgtcgagcgtc
gtctggggcatgccgggtgcggctgcccaggccgggctgtgcagcgccgtgctgccgctg
gatcgtatggccggcgaagtccgccggctggtcgacggaggaccgtga

DBGET integrated database retrieval system