KEGG   Tistrella mobilis: TMO_1226Help
Entry
TMO_1226          CDS       T02128                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tmo  Tistrella mobilis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TMO_1226 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    TMO_1226 (cheB)
Enzymes [BR:tmo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     TMO_1226 (cheB)
Two-component system [BR:tmo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   TMO_1226 (cheB)
Bacterial motility proteins [BR:tmo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    TMO_1226 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1345820..1347007
Genome map
AA seq 395 aa AA seqDB search
MVVDDSAVIRGLFIRVLEADPEIRVVASAANGRIALNQLKRQPVEVVVLDIEMPEMDGLT
ALPELVRAQPGLKVIMASTLTRKNAAVSMEALAKGAVDYIPKPSATSEVYSNEGFSRELL
AKVKAHADRGRRDGTAPALGGGAAAPAAPAAAASPTTAYRPRTEPAAPAARPAAVPAAAA
DLPQRLGLQRKPVVLRPFPPAFRAKALAVGSSTGGPQALFTLFGALGPALQRIPVFITQH
MPATFTTILAEHLARASGLPCVEAEDGMPVKAGRIHVARGDWHMVPTEAAGGAVIRINQD
APENFCRPAVDPMLRGLAKIYGRNLLTVILTGMGSDGQRGGEHVVQAGGVVMAQDEASSV
VWGMPGAAAQAGLCSAVLPLDRMAGEVRRLVDGGP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcgacgacagcgcggtcattcgcggtctgttcatccgtgtcctagaagccgat
cccgagatccgtgtcgtcgcctctgccgcgaatggtcggatcgcactcaaccagctgaag
cgccagccggtggaagtggtcgtgctcgacatcgagatgccggaaatggacggtctgacc
gccttgccggagctggtgcgggcgcagcccgggctcaaggtcatcatggcctccacgctg
acccgcaagaatgcggcggtcagcatggaggccctggccaagggcgcggtcgactacatt
cccaagcccagcgccaccagcgaggtctactcgaacgagggtttctcgcgcgagctgctg
gccaaggtgaaggcccatgccgatcgcggtcgtcgcgacggcacggcgccggcactcggt
ggcggtgccgccgcaccggcggcacctgccgctgccgccagcccgaccacggcctatcgt
ccgcggaccgagccggcggcacctgccgcacgtccggccgcggtgccggccgcggcggcg
gatctgccgcagcggctgggtctgcagcgcaagcccgtggtgctgcgcccgttcccgccg
gccttccgggccaaggcgctggcggtcggcagttccaccggcggcccgcaggcgctgttc
accctgttcggagcgctggggcccgcattgcagcggattccggtgttcatcacccagcac
atgcccgccaccttcaccaccatcctggccgagcatctggcccgcgcaagcggcctgccc
tgcgtcgaggccgaggacggcatgccggtgaaggccggtcgcatccacgtcgcccgcggt
gactggcacatggtgccgaccgaagcggccggcggggcggtgatccggatcaaccaggac
gcgccggagaatttctgccggccggcggtggatccgatgctgcgggggctggcgaagatt
tatggccgcaacctgctgaccgtgatcctgaccggtatggggtcggacgggcagcgtggt
ggcgaacatgtcgtgcaggcaggcggcgtggtcatggcccaggacgaggcgtcgagcgtc
gtctggggcatgccgggtgcggctgcccaggccgggctgtgcagcgccgtgctgccgctg
gatcgtatggccggcgaagtccgccggctggtcgacggaggaccgtga

DBGET integrated database retrieval system