KEGG   Tistrella mobilis: TMO_1348Help
Entry
TMO_1348          CDS       T02128                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tmo  Tistrella mobilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tmo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tmo00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tmo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tmo00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tmo00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:tmo00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1492005..1493099
Genome map
AA seq 364 aa AA seqDB search
MRFPDGSPSQPGRPQRGGSKTERPAAPRPQPDLLIADLGGTNLRIARRDGRGRTVLLGRF
ASHEIEDLPDLLRRVWLKAAGRVPAALAIAVAGPIDHGAGQARLTNHPALAISSAAIARA
LGLRGIAMVNDLAAQAMGLALGAGGTREMVAPGTPDDEAPRLLIGLGTGFGTALILPGRG
GLPQVVPAEGGHVTLAAETAAEWAVIEAARPLPGTAGVNDHVSAEDLVSGHGLPRLAAAV
AAVRGLAPVQGEAEAVTEAALAGDAGAREAFELFSGWAGAVAGDLAIATGARGGVVLSGD
LLHRLGGLFDRRRAAARFRAKGRFSAYLANVPLELAPAGDDLAFAGLTGIADAVAAREAG
PVFD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttcccgacggcagcccctcgcagccggggcgcccgcagcggggcggttcgaag
acggagcggccagcggcaccgcggccgcagcccgatctgctgatcgcggatctgggcggt
accaatctgcgcatcgcccggcgcgacggccgcggccggactgtcctgctcggccgcttc
gccagccacgagatcgaggatctgcccgatctgctgcgccgggtctggctgaaggcggcc
ggccgggtgccggcggcgctggccatcgccgtggcgggcccgatcgatcatggggccggg
caggcgcggttgaccaatcatccggcgctggcgatctcctccgccgccattgcacgggcg
ctgggcctgcgcggcattgcgatggtcaatgatctggcggcccaggcgatggggctggca
ctgggggcgggcggcacgcgcgagatggtggcgccgggcacgcccgatgacgaggcaccc
cggctgctgatcgggcttggcaccggcttcggcaccgcgctgatcctgcccgggcgtggc
gggctgccgcaggtggtgccggccgaaggcgggcatgtgacgctggcggcggaaactgcc
gccgaatgggcggtgatcgaggcggcgcggccgctgcccggcacggccggggtgaatgat
cacgtctcggccgaagatctcgtttccggccacggcctgccgcggctggcggcggcggtt
gccgcggtgcgcgggctggcccctgtccagggtgaagctgaggcggtgacagaggcggcc
cttgccggcgatgccggggcacgggaggcgttcgaactgttctccggctgggcgggggcg
gtggccggcgatctggcgatcgcgaccggcgcgcgcggcggcgtggtgctttcgggcgat
ctgctgcatcggctgggcgggctgttcgaccggcggcgggcggcggcgcggttcagggcc
aagggcaggttttcggcctatctcgcgaatgtgccgctggaactggcgccggccggggac
gatctggcctttgcggggctgaccggcatcgccgatgcggtggcggcgcgggaggcgggg
ccggtcttcgactga

DBGET integrated database retrieval system