KEGG   Tistrella mobilis: TMO_1348Help
Entry
TMO_1348          CDS       T02128                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tmo  Tistrella mobilis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TMO_1348 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TMO_1348 (glk)
   00052 Galactose metabolism
    TMO_1348 (glk)
   00500 Starch and sucrose metabolism
    TMO_1348 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    TMO_1348 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TMO_1348 (glk)
   00524 Butirosin and neomycin biosynthesis
    TMO_1348 (glk)
Enzymes [BR:tmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TMO_1348 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1492005..1493099
Genome map
AA seq 364 aa AA seqDB search
MRFPDGSPSQPGRPQRGGSKTERPAAPRPQPDLLIADLGGTNLRIARRDGRGRTVLLGRF
ASHEIEDLPDLLRRVWLKAAGRVPAALAIAVAGPIDHGAGQARLTNHPALAISSAAIARA
LGLRGIAMVNDLAAQAMGLALGAGGTREMVAPGTPDDEAPRLLIGLGTGFGTALILPGRG
GLPQVVPAEGGHVTLAAETAAEWAVIEAARPLPGTAGVNDHVSAEDLVSGHGLPRLAAAV
AAVRGLAPVQGEAEAVTEAALAGDAGAREAFELFSGWAGAVAGDLAIATGARGGVVLSGD
LLHRLGGLFDRRRAAARFRAKGRFSAYLANVPLELAPAGDDLAFAGLTGIADAVAAREAG
PVFD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttcccgacggcagcccctcgcagccggggcgcccgcagcggggcggttcgaag
acggagcggccagcggcaccgcggccgcagcccgatctgctgatcgcggatctgggcggt
accaatctgcgcatcgcccggcgcgacggccgcggccggactgtcctgctcggccgcttc
gccagccacgagatcgaggatctgcccgatctgctgcgccgggtctggctgaaggcggcc
ggccgggtgccggcggcgctggccatcgccgtggcgggcccgatcgatcatggggccggg
caggcgcggttgaccaatcatccggcgctggcgatctcctccgccgccattgcacgggcg
ctgggcctgcgcggcattgcgatggtcaatgatctggcggcccaggcgatggggctggca
ctgggggcgggcggcacgcgcgagatggtggcgccgggcacgcccgatgacgaggcaccc
cggctgctgatcgggcttggcaccggcttcggcaccgcgctgatcctgcccgggcgtggc
gggctgccgcaggtggtgccggccgaaggcgggcatgtgacgctggcggcggaaactgcc
gccgaatgggcggtgatcgaggcggcgcggccgctgcccggcacggccggggtgaatgat
cacgtctcggccgaagatctcgtttccggccacggcctgccgcggctggcggcggcggtt
gccgcggtgcgcgggctggcccctgtccagggtgaagctgaggcggtgacagaggcggcc
cttgccggcgatgccggggcacgggaggcgttcgaactgttctccggctgggcgggggcg
gtggccggcgatctggcgatcgcgaccggcgcgcgcggcggcgtggtgctttcgggcgat
ctgctgcatcggctgggcgggctgttcgaccggcggcgggcggcggcgcggttcagggcc
aagggcaggttttcggcctatctcgcgaatgtgccgctggaactggcgccggccggggac
gatctggcctttgcggggctgaccggcatcgccgatgcggtggcggcgcgggaggcgggg
ccggtcttcgactga

DBGET integrated database retrieval system