KEGG   Tistrella mobilis: TMO_1348Help
Entry
TMO_1348          CDS       T02128                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tmo  Tistrella mobilis
Pathway
tmo00010  Glycolysis / Gluconeogenesis
tmo00052  Galactose metabolism
tmo00500  Starch and sucrose metabolism
tmo00520  Amino sugar and nucleotide sugar metabolism
tmo00521  Streptomycin biosynthesis
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TMO_1348 (glk)
   00052 Galactose metabolism
    TMO_1348 (glk)
   00500 Starch and sucrose metabolism
    TMO_1348 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    TMO_1348 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TMO_1348 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TMO_1348 (glk)
Enzymes [BR:tmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TMO_1348 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AFK53187
UniProt: I3TK99
Position
1492005..1493099
Genome map
AA seq 364 aa AA seqDB search
MRFPDGSPSQPGRPQRGGSKTERPAAPRPQPDLLIADLGGTNLRIARRDGRGRTVLLGRF
ASHEIEDLPDLLRRVWLKAAGRVPAALAIAVAGPIDHGAGQARLTNHPALAISSAAIARA
LGLRGIAMVNDLAAQAMGLALGAGGTREMVAPGTPDDEAPRLLIGLGTGFGTALILPGRG
GLPQVVPAEGGHVTLAAETAAEWAVIEAARPLPGTAGVNDHVSAEDLVSGHGLPRLAAAV
AAVRGLAPVQGEAEAVTEAALAGDAGAREAFELFSGWAGAVAGDLAIATGARGGVVLSGD
LLHRLGGLFDRRRAAARFRAKGRFSAYLANVPLELAPAGDDLAFAGLTGIADAVAAREAG
PVFD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcgctttcccgacggcagcccctcgcagccggggcgcccgcagcggggcggttcgaag
acggagcggccagcggcaccgcggccgcagcccgatctgctgatcgcggatctgggcggt
accaatctgcgcatcgcccggcgcgacggccgcggccggactgtcctgctcggccgcttc
gccagccacgagatcgaggatctgcccgatctgctgcgccgggtctggctgaaggcggcc
ggccgggtgccggcggcgctggccatcgccgtggcgggcccgatcgatcatggggccggg
caggcgcggttgaccaatcatccggcgctggcgatctcctccgccgccattgcacgggcg
ctgggcctgcgcggcattgcgatggtcaatgatctggcggcccaggcgatggggctggca
ctgggggcgggcggcacgcgcgagatggtggcgccgggcacgcccgatgacgaggcaccc
cggctgctgatcgggcttggcaccggcttcggcaccgcgctgatcctgcccgggcgtggc
gggctgccgcaggtggtgccggccgaaggcgggcatgtgacgctggcggcggaaactgcc
gccgaatgggcggtgatcgaggcggcgcggccgctgcccggcacggccggggtgaatgat
cacgtctcggccgaagatctcgtttccggccacggcctgccgcggctggcggcggcggtt
gccgcggtgcgcgggctggcccctgtccagggtgaagctgaggcggtgacagaggcggcc
cttgccggcgatgccggggcacgggaggcgttcgaactgttctccggctgggcgggggcg
gtggccggcgatctggcgatcgcgaccggcgcgcgcggcggcgtggtgctttcgggcgat
ctgctgcatcggctgggcgggctgttcgaccggcggcgggcggcggcgcggttcagggcc
aagggcaggttttcggcctatctcgcgaatgtgccgctggaactggcgccggccggggac
gatctggcctttgcggggctgaccggcatcgccgatgcggtggcggcgcgggaggcgggg
ccggtcttcgactga

DBGET integrated database retrieval system